The URL can be used to link to this page

SDR88-13 POOR QUALITY RECORD PLEASE NOTE: The original paper record has been archived and put on microfilm. The following document is a copy of the microfilm record converted back to digital. If you have questions please contact City of Tigard Records Department. .;• I , l f ■ j Si,cZ.,..'0...)..) ...-.--.--- . , YIT . , 1 Ft).Tz2..G.R... -,1-2-25::)100(./qs-,:lc,,, " t:1, `�i V ... I • L iJ I, I I, P .. ,� N I • • • 1r •1r,rl r�C j 1, • • • ', '' ROBERT A, SANDMANN, P.E, , Mahrtenanee 8rrgtheer � I n; ;, HiIGNWAY DIVISION , a. � Metro Pegioh ii; . .; $� bepai`tmal1>`of 7"rarispcirtatfan 002 5 „MbLrsutittllri thud. MilWgukte 9722g Pi t(Jne 5fi3-3090 i,, , ` ',, I• I r �1 I .. 1 h •',1, , j ° III f .. .. .,.. ._. _ ...... ..-... ,._.....lu.. ......... .,.. . .. x,.,v...n..x.,........Lr.,„_n......r..e 1... u.. t.lw a J... ...x .,-a., w .•. • CITY OF TIGARD • t Washington County„ Oroson ' ..;, NOTICE OF FINAL ORDER - BY PLANNING COMMISSION I. Concerning Case Number(s): PD 88-w03 SDR 88 13 , 2. Name of Owner: Carl W. Hector _____ w---•-• r, 3. Name of Applicant: Carl We Hector Address 15300 SW Pacific Highway City. Tigard state OR Zip 97224 • 4. Location of Property: Address_ 15300, SW Pacific Highway , Tax Map and Lot No(s)., 251 10DT3 lot 500 �'•• 5. Mature of Application: A request for Site Development Review approval , to'construct a new nurser-77-r=ing and remote,ian ex-.string Ouse IriTo a retail shop. Zoning: C�G PD Genera Commercia , Panne Deveopment. 6. Action: - Approval as requested xx., Approval with conditions Denial. • 7. Notice:. Notice was P ub is ed in the newspaper, posted at )City Y Hall and mailed to: xx The applicant & owners xx owners of record _..._._ within the required distanre, • xx The affected Neighborhood Planning Organization xx _ Affected governmental agencies ,:: ' �. 8. Final Decision:, • 9. s�.u�y '�� F��A� �N� A� � UNLESS C�P��AL,�� zL Eli. . The adopted findings of facts deeisi©nb and statement of condition can be obtained from the Planning Department, Tigard city Hall, 13125 SW Hall; P.O. Box 23397, Tigard, Oregon 97223. 9. Appeal: ,., 4 I,:• ".: • . Any party to the docis`on May appeal t hi0 decision in accordance with 78.32.200(A) and Section 13.32.370 which g r cVi1os that a written appeal e is : may be filed "�.. .' ��... given and within 10 days after notice � nd. sent. The deadline for filing of an appeal is 3:4�tuc,�ttt3� 988 • h0► Q uestins If you have an y questions, p lease call the City of Tigard Planning Departme .t, 639-4171 (0257P) a l `` '�• c"' _ ., b. . ii , . . . • . • , .. , 44 • ; r . c '',4:;„.• ;,. • 1 4: , • . • • " • . *t-'ti .1 ' CITY OF TIGARD OREGON ‘, L44.P.:511( 9 SITE DEVELOPMENT REVIEW APPLICATION . . , • ,,, , CITY OF TIGARD, 13125 SW Hall, PO Box 23397 Tigard, Oregon 97223 - (503) 639-4171 FOR STAFF ONLY . , Tigard, '',. CASE NO. pc) 88O3 5tt 1Z se 43 . OTHER CASE NO'S: , . ,• LE:E CurvoiNe4darrvi _ tel3i- 6i40 RECEIPT NO. _11.121-.2,..._ • APPLICATION ACCEPTED BY J(:41;*Ve ,- .. , DATE: NjukOe rs.42.11±E2 7 •' 1. GENERAL INFORMATION Application elements submitted: ., ,- \ .. PROPERTY ADDRESS/LOCATION 111,562C) ....___ E $ Cii_1.1:11I7 , _.4,, (15 Application form (1) P i F ( - _ s , Oer's signatre/wr itten . , TAX MAP AND TAX LOT NO. • /S t tO 12).B , authorization , - i---->':-'--"---- .-''--- SC C 41,... )) ::l: :a:sfr Instrument (1) SITE SIZ E 4 2,0 0 t _____ : es: a:p (1) _.m.,„„... PROPERTY OWNER/DEED HOLDER.*.C ...... ..,, %......,t1) Plot plan (pre-app checklist) ADDRESS t',V CID e.,7,-)W (-?:-‘ttl.kri:•,EyHONE "./ 22.4:- q 8 4( CITY :i...s_q_62K...21_, ZIP ,....21z2Lt.,...2_,_"-2 f5 Applicant's statement (pre-app checklist) . ' . , . . APPLICANT* ra:2,La -..16) List of property owners and . ' '. ADDRESS \530(:), ....L2._IA=f4 , PHONE Z.,....3e......___-C_J't,634- .1" addresses within 250 feet (1) , -' ,... CITY --- --1MA,c ZIP _aill.a (H) Filing fee (1; i51? ) EOM v 1 1 t 6 0 At ,'Fe *1Then. the owner and the applicant are different r 7 5t people, the applicant must be the purchaser of record 4. 7r or a leasee in possession with written authorization DATE DETERMINED TO BE COMPLETE: from the owner ot an agent o the owner with wr1ten __________________ ' , authorization. The owner(s) must sign this , Iv , ...'-' application in the space provided on page two or FINAL DECISION DEADLINE .'' submit a written authorization with this application. . 0 a , COMP. PLAN/ZONE DtSIGNATION: 2 PROPOSAL SUMMARY * ., _ The owners if - ______record of the subject property request site development review approval to N.P.O. Number: allow -- L...1 - C ifj r , -1.--, 041A.a.0 _ - Arej-.7c0 v :5142.4____Y.e.lhiale....SJAJA ....) _ Approval Date: . ,1_2 ,,LA S-11; ),4 SIVt./21k-e_, -Paw. .L.i ptail Approval Date: L--0 \refLek.,1 t ,ir,-46. Planning Engilleering 1 : • ' 0524P/13P , • .', Rev'd 5/87 , ' li" ,0 - . • , :„. : • , — '', ' 1 " * ' . ' , 1 ' .4 , . , ,------- 4w,, , 3. List any variance, conditional use, sensitive lands, or other land use actions to be considered as part of this application: 1l1t .L / 4. Applicants: To have a complete application you will need to submit .attachments . described in the attached information sheet at the time you subd.i t this application.• . 5. THE APPLICANT(S) SHALL CERTIFY THAT: deed restrictions that may be A. The above' request does not violate any yam, attached to or imposed� upon the subject o 1..!5y. �• B. If the application is granted, the applicant will exercise the rights granted in accordance with the terms and subject, to all the conditions and . limitations of the approval. C. All of the above statements and the statements in the plot plan, ' 1 attachments and exhibits transmitted herewith, are true; and the applicants so acknowledge that any permit issued, based on this ' application,l may be revoked if it is found that any such statements are ' , false. .' ,1. The applicant has read the entire ccltents of the application, including . the policies and criteria, and understands the requirements for approving or denying the applicatio :,; . • . DATED this day of .% � l9 -d: - • SIGNATURES of each owner (eg. husband and wife) of the subject pr© ter ' �''. lire - ` • w J. , i I 1 rwrer+wa•r1.+iww:w. �I - I 1 • (ISL:pm/0524P • • • , e 1 I , + / M , . . . „ ,„,„:.. , , „ . . 1 , „ c . , „ . , . , , ... . . , .,.. ., * i .l.a. ` �f r , A,: '' '...,,' .f4,,,o 4+1111 ITV OF TIGARD ,TREGON 1 , : AiattatittaltkEEVE VARIANCE APPLICATION 'CITY OF TIGARD y 13125 SW Hall, PO Box 23397 . ' , 1 Tigard, Oregon 97223 7 (503) 639°- 171 FOR STAFF USE ONLY ,L ; CASE NO. i' '• OTHER CASE' NO'S: 8"'f 3 O3 . , ' . .5,0f? t RECEIPT'NO,., , '. APPLICATION ACCEPTED BY: . .-t i j'L-�,, ; IDA TE: 7..- ,III► r • .: 1. GENERAL INFORMATION Application elements submitted . PROPERTY ADD'OS S/LOCATION � ��0O ,s G _ p 51 f�� t A) App lication fprm HO 1� . t . , 03 Owner's signaturel, 3.tten , TAX AP AND TAX L M OT NO. woth ,s j_ 1� thorization Tax Lot. No. 5 0 0 , .. • (C) T3t trans �.r instrument (1) � SITE SIZE a _ _a . ....... (D) Assesso ,'�: map (1) r i�' ' . PROPERTY OWNER/DEED HOLDER (E) Plot •. an re--a check list , �'ar anr7 � '�P� J�P �?. — PP list) ' . 1 ADP48SS'1 3.0- —,S. ' '. . • PHONE �.-g 4 i (F) APP leant's st teMent ' d .., C2LTY ZIP .._.....1.2.2.21.______ . pre-app check ]I t,). , . ..._....... APPLICANT* C List of property own and '.; , ADDRESS PHONE '' addresses within 250 feet 1), .. \ ''' \•r CITY Z CH) Filing fee ��'P *When the owns 1 , ,4,, •F�'. * r and the applicant are different h.e a �,�. horization oases must be the ptirchaser of record �7,l;1 , people, the applicant ass �� .� ; or a leases in p lion with written DATE DETERMINED TO BE •COMPLETE � 1 from the owner or an •agent of the owner with written `L 7 authorization. The owners) tnustsign this � �� ' application in the space provided o n page two o r FINAL DECISION DEADLINE; , F.• submit a written authorization with this application. ` M PLAN/ZONE MSIGNATZON 2 PROPOSAL SUMMARY El � e Y P ` The owner s of record of the subject property i :',:',-. ''' request permission for a Variances to the N.P b 0 6 T umber following provision(s) of the Community . Development Code. Approval, Date; , Ptal Approval of Conditions s Chapter 1.8., 10 6 (re+ ui�r i ng paved parlking) w which would allow Us to maiht in the banning. See ) , n . .. rr�nt r . � o� a�v�l lot,:� (, �-��:�l�e�.��le�ter� �� Luigi eerii�g v'do f8 I I h • , 3. List any variance, conditional uses, or other land use actions to be considered as part of this application: ______221L_ . 4. Applicants: To have a complete application you will need to submit attachments described in the attached information sheet at the time you submit this application. CERTIFY THAT . PLICANT S SHALL . TH.E 'AP A. The above request does l not violate any deed restrictions that may be attached to or imposed upon the subject property. E. If the application is granted, the applicant will ( exercise the rights • . granted in accordance with the terms and subject to all the conditions and limitatiqns of the approval. the statements in the plot, plan . C. All of the above statements and plan, I • attachments, „ and exhibits transmitted herewith, are true; and the applicants so acknowledge that any permit issued, based on this application, may be revoked if it is found that any such statements are false. ;,; D. Thel applicant has read the, entire contents of the application, including ; { f; the policies and criteria, and understands the requirements for approving or denying the application. DATED this t3ri i-_ ,.;'�; , day. of :1 19 88 r I • II SIGNAT '►RES of each owner (eg. husband and wife) of the subject property. ,/i,,/,,/, ' I)4 '*-74--- ,,',,„6,,',.. -2,,, , I l' ' 1 ' rYwlYri.w"' "' �••, i-s•nlNlnwww.�.aYr.l.�lrtw� . d I y I. _ e (Kgb.pm/0737P) . I h • • M il,l .N • 1 i',..,.»:. .:4. of r '.r....Y. .n..............•,..........'A_ . • • _..: .',..._i r. ..•,r....'.. xr..:...,..-.f.........r...- ...J._. ..:4..i..r - ..............r,r...:.rn.. _.' _;.. ... -:r r Y1.. ..1.r4 F..a u • Request for Variance from the Tigard Planning Commission • Iespectfu .y Submitted by Hector's Nursery 7-26-88 r r the to maintain � . � e �be .i. v � our request for a variance I ' current gravel parking lot at Hector's Nursery will not be . 'materially detrimental to the purposes ' of the Community Development Code. Due to the special circumstances of the r nursery business a gravel lot is preferable because it ai..ows simple, clean drainage. A paved lot would be more likely to form puddles and retain spillage inconveniencing our customers. Additionally, improvements in the abutting r , properties are likely to occur in the next three years or so and it would be more economically feasible and ' architecturally practical to do all paving, curbing etc. in ' conjunction with our neighbors rather than having to repave at s'rc.h time as their improvements are made, We have spoken to the Highway Department and they concur as long as we agree to make those improvements at such time as the adjacent properties make them. This is, more logical because new highway ,access will have to be created in conjunction with the abutting properties,at which time our driveways will move to the extreme at edges of the property. Without . .� the variance, any new paving, curbing or landscaping would have to be torn up and replaced. If we can wait to make these improvements, we can share the cost with our neighbors and will have a frontage with a more attractive continuity,l We have had our architect revise the site plan to include shrubbery along the grass strip separating our parking lot from the highway that will obscure the lot from view and create a more attractive facade. (The revised site plans will be submittbri. Wednesday morning, July 270 1988b) Respectfully Submitted 1 . " Carl and 'tthel Hector Hector's Nursery • r I o . � I • 1.1.1 r Y • ' ' .. f ✓r 1 1. J 1 • •b. 1.ti.. .,...,,,,, ,,,,,, ,, _... ,., ,.,.. ................., ._.,_ .. ,,._,_ _.♦__,..,,...,L. :'._,..r.. ,,.-.,i_.,.,..e......v«....,o.a ... .,». ,.,.J' .. A..,,..,,.«..r.,..,•,_..,,.w„•.,..a...n..a.,...a.....,....n.,....,....,,.,. ,.. .,.e.,_.:,..:0....»...., ,..,....,,.., .,,... ,' • TIGR) PLANNING CC MMl:G L(N~ �'FINAL ORDER NO, r I« "r«w«.«*" • A F"il1IF1lw. C)R JE:.R 13:IiiCi,,L1 II\IG 'I l:IM1O,:CNC7$ AND COIIICLUSI()l11 i WHICH APPROVES ,AIV APPLICATION ' 'r ' • FOR A SITE DEVELOPMENT REVIEW WITHIN THE PLANNED DEVELOPMENT OVERLAY ZONED (PID 33,:,«03/8DR 88-13) AI11C) A VARIANCE (V 88.«w24) REQUESTED 'BY HECTOR'$ NURSERY, • .rww,..,«ww«..,.«."e.....«.«.ww..+..ww.«...w",.. "..«.»,w.«......"«.»«.w«.,«««.. .«.«.«....w..w•«««.««.."»«. «....«w«.w«".,.w.N«r»wHH......www«I«.....«».w....l.«.....w«.««w.«.......«w.."«a".u.«.w...♦....... .«,.. "..«...w. "rile "i a.gjar\d Planning Ccaltmissxor} rHe`ixewetd the above application at a puk}l.:I.c; ..) , hearing on August 2., 1988 . This review w was prompted hard art, appeal of a • Dirk cat0Ir`' s d0cission to appr°0tr« th 0 request: subjeca't: to c:orid:I.•t: .oP15 "Iwhc i, ' •• a Commission based its decision upon the facts, findings, and conclusions noted • • below: 1• A f A. FACTS 1 •f ,4 1.. cAP rt 9.r'a l 41,1 ,c;r i1 a t ,P.I"� t 4. ASE : Planned Development PD 88—U3, Site Development Review t , SDR 88' 1,3, Variance 88-24 .-"or: • ry REQUEST: 8itea Development Review and Planned Development approval to . construct a t w 1,IteGl % ra ~Cot re :ai1 nursery building, ) • . . convert at existing 1 ,845 square foot residence Into a retail shop, and corl:str'uct various site improvements, Also . requested is a variance to the Community Development Code's regLt1.•e�ment that paI%r1(iiicJ lots be paved. The applicants icants ,. propo3 to Ie gain 't:h sit s existing gravel pal king?I sai Ca, 1 , .4.,, 'M. COMPREHENSIVE PLAN DESIGNATION: Gene�rral, Commercial 'ro'. c` ZONING DESIGNATION: C«,•rG (PO) •.". General Commercial, Planned Development ,, nt , Overlay .I APPLICANT/OWNER: Fector 's Nursery AGENT: Robert Ebert I • Calrrl. I"1eec:tolr. The Gial.ier'ia, Room !a32 ♦ 15300 SW Pacific Hwy, )21 SW Morrison I .• Tigard, OR X7;73 laulr'tlRttcl, C)6 >;�,C)+.a ! LOCATION: 15300 3W Pacific Highway (WCTM 281 1ODB, Tax Lot BOO) ' 1'1 , 2 1 13n�51<art�Lar}cl >"r t9.1,lr,�ati.0, } I.. w«,w« .,.«,,",.,«ww.IMw .,«,««««w".." ,. .." I:I • 1 lI r Subseque nt to annexation in December 1977, j i City Council in April 1978 rezoned d tht i s property from the County's RU «4 zone to the City's R-7 zone, The Pi&n designation at that time was Residential— Commercial. The nursery business was also granted Conditional Use 1 r appr°oval, by the Planning Commission and Site Development Review i . r approval 1;}y the Director c:t,carr Get: approximately the s rrt i:iittc� as 117r� zone ,`' ,e 1\ . change, A , During the revision of they Comprehensive Plan in the early 1980's, the l. Plan designation for this and adjacent properties was amended ei l:ti f General Coltntrarcital, and the zoning changed to C;«.G (PD) (General Y1:p Coiitmer\ci;t;1., Planned 0i vc l,opmt nt;ii r Because the parcel lrta$ been H I r ; with 1 designation,L 1 1 1 1 designated witht the Planned Development overlay ,rte si. nation, this type of development application must he reviewed by the Panning Commission. I FINAL ORDER IIIO. 03\.,, U! PC «w, HECTORS PD 8 03/SOR 80-13/V 88-24 — PAGE ). I I , • • i .. I ' e I F f: ! •I,.. 3 ..•. .• '' '• .I.t! Y ... ................ ........it ..H....-..w.+.., ...' '.' - .,. ,`•..,, ,Y._I..,,.l., x......,.• ... ...e ,J.,.w. . 1.N...,.. ....r.• .,..,.� ,, .n,J.,. w x N.w.xHww;H. »»H x ,w . , »..xx» xx.HxH • Properties r'•trit s t:o the north, south, and ea,•t. �:ar'e also zoned C—G (P0) . Parcels to the north and east are urcievelroped, the parcel to the southt is occupied by a single family residence a nonconforming use under • the present: zoning designation. Properties to the west of the subject arlcel across Pacific Highway are within Kirnc, City and are developed with multi—family dwellings Pacific Highway at this poirr is a four 'large divided highway with a i ' landscaped median. lilo curb, gutter, or sidewalk are present. I1Io left . '� turn lane into the subject property is provided for sotathbourncl r. i left turn lane is provided approximately 500) feat: south oi"' However,the subject property, lef t tur n at this location are ro . , longer legal due to Oregon State Highway Division roadway revisions. 4. 8i�e x 7ft t .c►t aHiM«r1ci xlxfx' ..2�'�9x;n l•u.H lr w x•»r"i r« fit HHHt«xrw .' w N r Nr .w The 1.36 acre site r s presently art s tntt y occupied b y an existing single family residence, a wo rk shop, a greenhouse used as a retail showroom, and two lr ' smaller greenhouses , The parking area is presently gravel surfaced and , , unn►ar'keci There are numerous trees on the site incluctirlg several trees in containers which have been placed around the parking kirlg arNea, ',•' The applicant proposes substantial renovation of the site to include , construction of a new 1,700 square foot: retail store abutting t�hr� . • existing house, construction of ,t new entrance gate and 'fence, erection , . . of a now sign, and the future conversion of the existing house for retail tasty. Use of the greenhouse for retail use will be discontinued • upon completion of the new retail areas, The site improvements and , buildings wi:Ill follow t.a Jal,a,anes garden motif, . Prr'ol,posed parking area improvements would include provision of 20 parking spaces at la 60 degree angle. One designated handicapped parking i:)r1l;Ca would be provided, The existing landscaping, isle:l.ut;lir'r ' tree. in containers, wot.iic:i be retained, A now 4 foot 9 inch tall Pence with rat : 4 foot tall decorative entry gate would separat e the retail ,r area from the parking kirncj lot;r 5, 0.9.nr c.,V aric;l 1111 c w.t�llrrrYtrartl.11 .. «Hx w...«w+w.xwx«ww«H«H«.Hx .r Hwwl«N.«w I Division " ' t;he fL• 'l following comments:' The Engineering M�4:are r ��„1 C,j i. >1 1, The subject: site fronts on Pacific Highway with two existing ,, �, c:ir°iueW ay entrances, Pacific Highway is under the jurisdiction c't” the Oregon State Highway Division. Access to Pacif°ic Highway ' must be approved by the H icjht>v._y Division, , •. ' 2. A public sanitary sewer exists approximately 500 foot;; south of the site along Pacific Highway, The site presently has two bathroom facilities with 2 septic $y$t:tarr;rs k The proposed new construction would not add any bathrooms, W ashingt:on County's s ' Hoy ,•th Department meat+ ►nu nt certify that the existing septic systems l ar o adequate to serve the 'changed use of the site, P . rxmAL ORDER NO, 80'-«09. PC HECTORS PO 88 08-13/V 88-24 — PAGE 2 •, ' • ,. . I • 1 0 1 ' 4; .,,.•.._,..i„_..., ,_.,,,.«.»......,..,....a..,...,._ ..:.!..•. ...,.._._..rv.,., _ .... ._.....ar, .a,_........._,..... ,..,��.v.,e. .....___..,,,.w«K,•.,. .. i.,..m....t«•L....,.. W,..,_„.. I......,.,« ..�„...,,..« .,•1,.',........i.«..,-._u.. ..... ` In accordance with City and Unified Sewerage Agency policy, . public sanitary sewers need not, be extended because the site is greater than 300 foot from the closest available sanitary sewer [• �, create 1 and the increased usage +fit'? the site w:i.l.l. not c.r eat e a rubsttanti,al. 1 demand •F:)rn sanitary waste disposal, The appiicant , wi.il. need to • • obtain written approval from the Washington C >unly � I 1"1�,.�ti.'Li°a, Department to continue to utilize the septic systems for the • • charmed use of the it 4o completely retail U . I� , 1 he site s; cs e s to the south tt at approximately 1. 10 2 percent, , The proposed project will expand the existing parking area, This I• will increase runoff the s site. t ; • • , adjacent 1 to order that runoff onto aro1 erty I wi ll not be E . increased, th e applicant a must provide for ro of of arc parking lot �' • .. • 4 ' : drainage to either 1 :, public s o rnwa t e r drainage system or an I, , ; approved on-s i.tc drainage age isy:stem l i i • The Oregon State ifi•ehway I"DivIst,oii commented that their standards normally would require that the applicant provide a rb, sidewalk, and :"*.-1.?..* 1 subsurface drainage facilities alont, the site's frontage. However, the L • r . I Highway w ill al low the construction o f th e necessary l., . right-of-way improvements to be deferred until such time as either of . • the adjacent parcels along Pacific Highway develops, It is ,noted that: ', : this could allow for the permanent access improvements serving the nursery to be shared with adjacent uses, thereby' reducing 'h1 number of ar-ceaa points along Pacific Highway, 14 N 1 S \ i +, 1 , ... .I:yhac� Highway Division also commented that at present the existing two , . :M• M , 1 , can, ' Y , , 4 1. " f fly acc. :� points c�ara lay maintained but that an access permit be obtained from the Highway Division's District 2A office. "., Washington County Fire District No, 1 and the Tigard Water lDi.str•:i.ctt • commented that a ire hydrant must iac i,>r'ovided within SOO feet of ,, i,1 buildings. The Eire Distr4ct also recommended that cnrtr! r.caw: y i',• vehicle access rrrc,r:�t be provided within ;i..�t;r feet c;�,r al.Il, portions of the buildings �r thi c l. • . The Water District also commented that additional water meter er , , connections must bo made, with coats to be bonne by the applicant. 'who District con mr•:nted that the new meter will need to be either a 1-1/2 I - • l inch or 2 inch motor depending viaori demand, � General Telephone and Northwest Natural Gas comment d that the • applicant should contact them rregar�di,ri, provisions for utility ' I I connections for the new building, J11PO 111o, 6, PCE, and the City of Tigard Building Division reviewed thc •• l'. proposal and offered ed no comments or ob j ec:t ,ons 1110 other comments were , ' received, FINAL ORDER NO, (381 _po PC - HECTORS Pt) 88-Oa/80li 80-13/V 88-24 - PAGlw, 3 I I I • I • t w a.", -.ni.A•,.•. •. ,.. - .'..,, �r, , .. �. ., ,.....' � '� ..I .,u ,. �w... r. _,m,.., ..I • ....,,..r. •.,,n. ,... ,.. L. ... .,�... • ,,.n.•.•• ., • S 1• U n . , „- ...........n.r,..«....,..4,�...„.,1n...f,.,.' ,.�,�..a_ -.u.._�., n,•..0'.,1 '.I « .....L. i._1.....,...w...«.... —+.... ..,s......»., n.... d.w. ,.. ..«.,..».... n. ., «Ja•..._,....i...., o,vf...++e,.._. u ,m m.« .........�w•.....-,r... ._..... ,,.i ....,.r. n- ..J.L......Y.. ..,li .,,I S» ...7. ...•51...». ,.W.,n .�.1'. J.. , gt • { 5 .!8, faitlf�r..YLh1tL� yy,... � The proposal for now construction and site improvements at Hector's .. Nursery conforms with Community Development Code C....G (General , ',.. Commercial) zone requirements for setbacks, building height, maximum site c.bverrege (85 percent),, and minimum site Landscaping (15 percent n 1 111 I' I 1 n 5h I 5 r1< !\ N I 1 \ 1 r 1 . recuir end, i t least 50 percent trot pr t v.idtact) 1 A nursery y is classified ited as am i, l s ..,{51,1515.+5. permitted P y t .a h 5„� The proposal' agricultural a a 1.�s use er a use c;. ni.rt the C. ewr” .a zone,rn e'S .,€.. complies with Planned Development tal'1Cl Chi;' e 'Gt1tellopri1<»('11; Review standards v• for :Lai ls1 J r Y Y Y I, 1 C;i1>i.r1c,�, s:i.gna�c , drainage, vi vision clearance, and parking . except with regard r d t,o paving of the parking lot, A variance has been; requested to that sta ndard, Parking, landscaping, and fencing warrant� . l :, further discussion below, including an analysis of the requested ' " . . variance, , rr rl T r r 4 1 Section 1 r aC6,030(c )( 3) of the Code requires hna parking space ( r • every 400 feet of gross floor area ra for• agricultural sales . e , establishments, . site 1 III 1 n''„ I The plan proposes s 20 p ,akin, spaces for the o 4,287 .. i1J s Ya e feet of proposed retai: space and workshop area, thereby . . satisfy,isatisfying i this requirement. Code Section 18,106,020(n) requires that . one appropriately :located and sized designated handicapped parking , space be provided for parking lots with between 5 and 50 parking ' designated : : pace s, The site plan provides for one handicapped parking � p . . .^ space a1 j a ce t to the mo r entry ga ta thereby s a tis f y i g this requirement, I , Section 1t ,106 050(i5) requires es that: parking areas be surar'facecl with •• ' , either asphalt or concrete, The applicants requested that the Planning .% 1 this to ♦ Commission grnar'tt: a variance tl$ tln,ts requirement to allow the existing, gravel parking lot to rrertrai In until either of the adjacent properties alongw 1 N 1 i M 1 1 r N request K.4 1 \ along Pacific Highway i s redeveloped,, °I"i..d to this variance r equest i s . the State Highway Division' s assent to allow deferring rxitg right.—of—way : ,.rt. improvements until the adjacent t.)r'operrt:1 es develop, Code Section 18 , 134,050 provides for granting variances s tro Code requirements upon a determination that the variance will not be detrimental to adjacent properties• nd physical or natural systems, ~ ' . will,:t, not conflict with the purposes of the Cole and Plan, that City standards wil1:i be maintained cl to the greatest extent possible by ' minimizing the extent of the variance, and that the need for the • variance arises f rnom c:i,r'c umstanc s peculiar to I the particular parcel °orr typo of development, In the present situation, because the adjacent properties afe presently ' . undeveloped, ho atdt/l ree impacts upon adjacent properties i.es i}1re frnr ese ee 1 Al t o.'1, no adverse impacts are spurn upon ph±j ical5 systems, such as adjacent roadways, or upon natural systems, such as drainage systems.. ✓ . Leaving the parking irg r t gravelled may even reduce impacts upon , , drainage systems because a gravel lot would typically Produce lose . surface rrueoi f than a paved perking area. ♦ . r FINAL ORDER NO, t#8-_op PC K5w HECTORS PD 8e7o3/SDR 08-13/v 88-24 ., POOL 4 I I I I I .1 • a 1 . 1 . A r • f r i � appear , r ' � " The requested t ia1ta does not t �Y n ca h ly conflict with . the , `n hCO( s intent in r'chqui;r'i;ntg commercial and industri i uses to meet tt cl cic iopmentt: standards typical of a city environment s • , yI tt . "I"Ite.. r,• the standard .a primary purposes r " parking area paving a � t � reduce dust �, ., �.: and mud effects upon adjacent properties and streets and also to . u pre$ nit: �a neat appearance of development along rttajorr, city streets. ...' —.- Dust and mud impacts resulting from the requested tram i roc r would be minimal, Aesthetic impacts are difficult to ascertain,a Btcau$e t•"ihe adjacent parcels are presently vacant nt anti Also because the parking area would be paved upon de ve lopment of tthese adjacent parcels, e the impact of the variance upon aesthetic concerns q e insignificant .,,,. . j and temporary,, `i"t'c appeearaanct of t-Jhe parking lot would not conflict • , with the appearance of act jaccnt prroperti,e s and btac t,tso of r'•. the other sit< improvements proposed, this site will �e attractive compared to other parcels, The Commission also f i.r7d s that the present situation of adjacent undeveloped parcels, the potential for dcvl, rtirtg joint accessc . • between the nursery and the adjacent properties, and the difference in '. grade between these properties are a unique combination , of i,N..... circumstances that distinguish the present s ituation from other properties within the zone and which justify the Commission granting „ the requested steel vaar'°►.<.uNre+»�. The Commission ' believes "that allowing the 1. . ' ., paving at the nursery it:) allow concurrent with adjacent development can • • possibly result in a coordinated acce$r; plan resulting in greater . traffic safety and opportunities for a. more attractive site, Because . ' o'f the grade c changes among these 1 "e 'a requiring , ' , i• r M par eels,call the paving car the nursery parking lot: at this time could make i coordinated access and - parking plant more expensive A$ 44011 ass difficult to accomplish, .. The Planning Cortti1ti,s 3i,on finds that the criteria for a variance are ,. . satisfied and therefore the requested variance to the paving standard granted The, aI i;t1i.e.a.Arttts s`ntal,1 work with 1:I1e. staff and the Ortelurt State .. N•ii:ghtwaay ni,tii,si.ctrh to cl0tirr.~•l,0ta rrrt agreement that rMluarreAntttwes that the a;9;)1:1t:antts or their successors shall both have the nursery parking r I I � r � ,� i;ta r It,y.r t� lot tt and :install, the r�i,gh'l;".of"way impr ov on►e nets r�Or:it.r i red by the I��I i.c;hway °l development adjacent . ;\ei ril Gch aa h at e :.h n of the parc h . t aaar�r<a s e,.ral:)i.rho t '{ The proposed landscaping along with the row plantings and nursery stock �', ( • on the site greatly earl;r.�echds the rtt:i,rta.r>`warn 15 percent of site area which � � : is required to bo handsc Aped, The trees in containers located d ara jaaccurt to the parking area satisfy the parking lot and street tree requirements. The planting of rhododendron bushes between the parking area Gartrl Pacific Highway ghtway wi.h l bring this site into i rr csrrrtarncc+ with kh Code's • requirement for parking lot screening. It i$ noted, however, that the rhododendrons mus t be relocated out of htr right—of—way and that Jj•t . rteorr'tahe r'rh",..rttosi: rr.'htododt�ndrretrh $htctt,rid J:x tweed out;. of the required visictir�t - - ,. clearanoe area for the northern access A revised vised s to plan must; :I be . submitted which makes these correction-3. 1 • 1 FINAL ORDER NO, 3o- 09 PC � HECTORS PD 8S"oaiD� 3-13/V 88-2 " PACE l _ I I ti w C "• / 11 ti a ° . I 1 • Y i 1 4:. •. Section I3, 100,090 requires that f ences be no taller than right feed ` ' , allows i . except when the approval authority l ws a greater height, The • 'j applicant proposes to separate the parking lot from the retail area of , the nursery through construction of a combination rock and cedar fence! with eta fourteen foot tall entry gate. The wa1.l, and gate are designed to, complement the Japanese garden motif of the buildings and garden, The Planning C;rarnlYt:i.s s,ion approves the G11/e Ir/1'tr irc{itt, entrance gate •rs M � (' 111i3;1yc.)s rtillil_ eit.1∎,!C1,..LISI01\1:a "_ P . it1111tf,D i�EV1'.1. itiri'iurl"/1:.�.X l"1 lei vl�1,..QPr.i .11lxl'r R1:-:VIl I,�l l 1Mx "uwr{uwu."..".uwuMxu,{rw.r ruwMUxw"rwr.lrWxu«ww.rwrwwrww.uuur�•«"r" wuWrlwwuM•u{xlrruMUxw"w.wwuwM.IWI .",•ru"unr•r•u.{"lurWwurwuuuuuM•N"« :5 a' r r. 1 ♦' .W 1 � I'f i to "h .a a � cx,Ja .Iallt,� lyltr.. Planned Dove c:�l`tGl :t)rte f'. . •• 1 „I',' Development Review sects of this application are Tigard Community d• Development Code Chapters :L62, 110.80, 18. 100, 18, 102, 18, 106, 18,108, r and :.8, ,I,64, , 1 • . d^ . The Planning Commis sion his determined rmin d that the proposal submitted ' ' with minor modifications, is consistent with relevant portions of th , ,1 Community Development Code based upon the following findings: ,.I 1 '4. a, Chapter 18.62 «(3 zone) is satisfied because a tnce proposal ° satisfies the b and dimensional requirements of the C " zone, F, , b . : b:i. Chapter 18,80 (Planned Development) is satisfied because the 4." proposal meets the requirements of the Planned Developrite?nL" • C km,",l{ay coca?, �' c. Chap",:er 18, 100 (Landscaping and EC r'c r?.II:1rncj) irs satisfied because I the proposed fencing and landscaping will provide an attractive (commercial development in compliance with all applicable Cod standards , d. Chapter 18,102 (Vision Clearance Areas) is satisfied because the ! provide , proposed site plan with minor modifications will ac adequate s . ' -. vision ciea ance for vehicular access f ca the �it� to Pacific m ( ',, ' H i cg hwa y, j; ; ;, Chapter 18,106 (Off Street': Parking) is satisfied becat,l t ! thy± parking lot plait satisfies Code requirements for number of 1 parking spaces and provisions for handicapped accessibility. , r. Compliance with the parking lot paving standard is deferred c rrr`ed until r• i'..0 futt.tr0 ad3ac:,c nt d icl,oprltc rtt occurs+ 1"ho a pp 1icant will rn'l;:tr into an arjreeiii( rt-i; to r tAar"avit oo. compliatrtc+.a with thtc pairing ' .∎ standard upon development of either of the adjacent parcels 7 : fronting P a c:,i f i c Highway, I f. Chapter 18,108 (Access) is satisfied' because the existing ' l' accesses to the site meet Code requirements,+ "l"he Oregon Highway Division may, however, require future access modifications, to provide joint c as;t' to ari jaac„+ nt I arc 1 s Any access a' modification will also be reviewed by City ;staff, i r. I' 't ,m f r. 1-IIllihiw 0RDIER NO. 88-J PC ..,W I'tl;:C;''I"C)R8 PO 38-08/ Ol f3e-ta/'V 88.24 I , PACI» 6 , • t i rr a J d r . ■ w....,..ws.1n..;J,+:...... ,...,. ..........1..,.....-.r,.r-......,r•r...-....,.v.. _,.n..,.I.,...r-... .,..r'.J,..».iglu....Id ...•..,.... ,...N,.,.......,t.....rr......,... + .•..., .... +.. .....t... .,.i. i, v,. 2 . Chapter 18.164 ( r and iliry Cd ) i tied 9 because the property owner will enter into ar agreement with 7 R , Oregon State Highway Division guaranteeing in t— I l7ent of the necessary improvements at the time either afjacen"" parcels (WCTM l a 281 1or30, Lots 4.00 'and 600) develop, . I� I 1 .i , , C. DECISION t Based upon the above findings and conclusions, the Planning Commission • aI)lprr'avE $ PD 88-08/8t)R 88"-:18/V 88-•24 subjection to the following conditions I' THE FOLLOWING AIC CONDITIONS SI'1AL,L. BE ME'l'` PRIOR '10 ISSUANCE E CSI'" BUILDING PERMITS,, $-r FI'=' CONTACT: GARY ALFSOi\l, ENGINEERING DIVISION (CONDITIONS a,,. 2, 4) JERRY <')F1'ER, PLANNING in:vxsxci I (CONDITIONS 3 5 and 6) . '` :,4i �4 ,'° 1 g 1 , . 1 s l:)t r'm i,t :h,tl,1. la ob•ta .reed Tir.carti •:tee Ore•fjorl ;;f;,ilt e I'1 i gi'lway , Division. 1 I lY cn 2 The applicant shall enter into an agreement rl en't: w:tth the Oregon on Staff)t e i' Highway Division guaranteeing that the applicants or their • ". h' r r• r responsible »� "1 for r property c. w:i.1.1, be ' successors c,.c{�;�3 c.�r s ;>w rt interest t t:z..r ��'L �.rl the I,a r ►,) ► i.•,l installing the above described improvements ent:s 1pri,orrl to occupancy of future commercial buildings on either of adjacent parcels tax '1 lots 400 or &00, 3 , The applicants shall enter into an agreement with the City of Tigard guaranteeing e:i,nf that, the applicants or their successors in ' interest in the property j;arr'fal:?ert;y wi,1,l, be responsible for paving the parking area concurrently ently with the construction of right—of—way i •r 1 improvements meer'tt:3 re l,at:e d to development ll►1J1)ient, col either of" the adjacent 1' Parcels fronting Pacific Highway. Said Agreement shall be 11 •' approved by the City t � A t t o r ney , a i 'R.; �, 4•, The applicant stall obtain W 1tt e l approval from .the Washington X ,..1..� r , County Health Department to utilize t he existing septic system, t �' � V Roof" and park I;ngl lot rain drainage shall be! conveyed to the S' public st otr'mwate.rr, drainage system or an approved on—site system } �2 r r designed to prevent runoff onto adjacent property, 1 r 1. ' 6, ,1he si,t;e Ilan shall bc. r'cavised to reloc�atej t;ht+ propose I tip. rhododendrons, out of the public right-of—way and out or the s + � 1 r required vision clearance area fr th e northern e n t a n c e, y '1 e tl, PRIOR TO THE it,SUAIIIC E OF AN OCCUPANCY . PERMIT i I''-Ord ANY NEW r l)tLl`.J;r~I1lGw ON 1 THE SITE, THE FOLLOWING CONDITIONS SHALL 8E MET TO THE SATISFACTION or THE PLANNING DIVISION, (STAFF CONTACT:'I" JERRY OFFER) I. • µ l 1 ORDER 1C1 88— Cy PC — HECTORS PO 8 4.0 8/8y r 88-18/V 88"2 4 . PAGE 7 '. J i , r CA • ......,,..- .,.,r„.444 ,....�.. ... :�.., 1..,. ....i-:-.s,.;w.. ...• S al..:,e�,,,,..,.�.....r...a� ,.-:i�:'`«,..,r.,a.,..,tl,u.,... .. ,. • 7. All. landscaping materials and other site improticairicmt:s shill be • . installed Ias per the cwt'pr±.+ov?d site plan, At , ' ItI 0, A sign permit shall be obtained prior to the erection of a new / Sign , + { and � M + 11 h•4 M with ' .. sign. Sin location 8i,zO will be in accordance witch' the. • provisions of Section 18, 114 of the Community Development Code, } THE APPROVAL SHALL SE VALID IF EXERCISED WITHIN ONE YEAR or THE FINAL t, . • • APPROVAL DATE, It as further l ":e'ec that the application and the a >7e11 ar1 be notified cat" the entry of this final order. I pAssfiD This 9trh day o f 1980, by the Planning F' ' 'i wM«•«w.www.µ.0..11w H ••,Nw w,' w,www{w«. fwww«•.wwwwwu.l«IwMw••,ll � . Commission of the City of Tigard, } {1 1'1 1 -y i'e, 1 C. 9r 15 c tr 1"ic �arlc;l Pl,ann±i .��►itilrr;i:;�:}�.on c lit:/564! I D• 7c t I 1 HECTORS w« «.M — PACE 0 ' FINAL t�I�C1C;�1�, !1!C"1, 00�. f�9 PC w�2 !`�� t�8/;if.�i'� 4�0 �.��V E3b�� rr �} .,._,.,,:.,..a._i,a,..,,,�' «,_...-. ,.aw...,...,..w,.wl,w, .�..,.,_.,,,.„u.C..,if:,'..iwf.a,.,«.,,,«;a:.,'.,,..�.�..a4«,a:» -._.».. .. .w �>,,..,»..«eH..,:...,k.....u- _,�,.•..e,.«r. ..�._-. -..,,....«,, .. 7x w • of • Carl Hector • j. ". . 15300 SW ,Pacific Hwy. Tigard, OR 97223 Lee Cunningham • a 13385 SW 115th Tigard, OR 97223 ti . Jill Hector { • 2607 E. 22nd . St. o Vancouver, Washington 98661 • - -- 1': G vt�11` • • fi • ir • , u i • L' r 1 • ., s»J..«.G�... f.,.._.......�... ..a..,.,k. '..._w-a...A...:...a.a ...:........:A;.,44..�,w'iv.....�..,...t r,.i tin rte.x..«w,4+A.;w:..r'..�m-• ,w.,. .,, - , :d.,.+z.+L'•-.iw.kla:■elt;t+ u,.-.:.i�y��a k,•....�,.wx t....dr.. ... a...xri-A,�u; o CTOR'S NURSERY 15300 SW Pacific Hwy. TIGARD, OREGON 97224 (503)639.9841 Agreement: 2/10/89 • Between Carl Hector and the City of Tigard Hector' s ,Nursery located 15300 S.W. Pacific Hwy, Tigard Or. 97224 will at the time`�'of the adjacent property developement change ] � P y Dement or a �hange in use of the Hector property install curb-sidwalk and storm drainage, also pave the parking lot with proper landscaping. Carl Hector . � r IJ I 11 1 I j �' " , • •4 a r 89- 17696 .` Washington County r;. i' DEVELOPMENT AGREEMENT This agreement is entered into this /7 day of re , 1989, by and between Carl Hector ("Hector") and the City of Tigard ("City"). RECITALS 1. Hector is the owner of certain real property located at 15300 SW Pacific 'Highway, Tigard, Oregon (WCTM 251 10DB, tax lot 500). Legal Ka ' description of this property is attached to this agreement in Attachment A. M. 2. On August 9, 1988, The City of Tigard Planning Commission approved the Planned Development - Site Development Review request for expansion and remodeling of Hector's Nursery located at 15300 SW Pacific Highway. The Commission also approved a requested Variance allowing the parking lot on the site to remain gravel surfaced until such time as either, of the adjacent parcels fronting on Pacific Highway (WCTM 251 10DB, tax lots 400 and 600) are developed or until a change of use occurs at 15300 SW Pacific Highway, whichever occurs first. Improvement of the public right-of-way adjacent to the site with curb, gutter, Storm drains, and a sidewalk was also allowed to be deferred under the same conditions and timetable. 3 o The parties intend that this agreement shall be recorded and shall bind Hector, his successors in interest, and assigns in the property as follows: AGREEMENT The parties hereby agree that: 1. Hector agreed that within 120 days of notification by the City, Hector • shall complete the following: � r ad parking lot, �.5 300 SW Pacific Hi driveways, and hwaapproarhes serving the Highway. b. Construct pUblic riht-of-way improvements to Oreon state Highway ion Standards right-of-way g `mum 5 foot wide sidewalk, curb andi gutter and Subsurface storm that portion of the x.na. and gutter, i"irainlh for l r - y �t abutting the subject property..... Hector Shah. public right-of-way abirtt3�n ' obtain. ., v' on... .... a permit from uh�,. Oregon State .Highway Di psi to perform Work within the right-of-way of Pacific Highway.' A copy of the p ermit Shall be provided to the City Engineering nearing Divsion prior to issuance of a City Public Improvement Permit. RETURN RECORDED DOCUMENT Tod CITY RE COR7ER TIGARD � P 0 EOX 3397 IIGAgn OR 97223 /I gm' • • -P•N., .1 ..wx- x .Ga..-..—.A Lr,.r w.r a., w _. art. rrk nU X • .. u ..0; • un w.a w. _.. ... .t • • 2. City notification to Hector under (1) above shall be triggered either by: a. City approval of a building permit for construction on either of. adjacent tax lots 400 or 600 WCTM 2S1 10D8,; OR b. A change of use of the Hector property as described by the Community Development Code; I , c. Further expansion of the existing use which requires Site ~ . ' Development review of the proposal as prescribed by Section 18.120 of the Community Development Code. 3. Failure by Hector to perform the above obligations upon notification by • the City within the prescribed time may result in any of the following actions by the City: I I a. Recording of a zoning violation on the property which has the effect of blocking issuance of building permits or land use approvals for any further development on the parcel. b. Construction of the necessary improvements as described in 1(a) and 1(b) above to be completed by the City or its agents with total costs of such iitprovementa to be assessed to the property. 4. The parties agree that this development agreement shall be binding o n Hector, his successors, and assigns. IN WITNESS THEREOF, the, parties have e this agreement' , p s xeciutod pursuant to authority vested in each of them; ;1 ; TTG.: ) PE RTX I Director of C•/ unity *eve opment ' (Attach Nots.ry AckknoWledgement hereto) r � I I • • I I I I I I I. I " n 4 •_pal a n it i I I (. • ■ • ' .........,F.....F.......n..t•.w,a_a...-.�..J,•.J r.M...,.,i..u...4.+n,.•...............w-...al:...�✓..x..i.,.,.. ...... .•,..ti..l..,,a,... _ ..-._• ....•...L....,1✓...n.aA......r....u,.-.•-a.M ...,....-. A'�.xr.+r,a.....................L.a...,.r.,..�.....-.n.w..,.... .a.4.,i....r.a.l.,..v.r.:N.J..,....o-�...�.u•....«.x, +ki:.r+A,lC.w a.�.u.h L.i.u....a_a. - ., � -.,✓x.r-•.. STATE OP OREGON ) )saw County of .._. ) On this 7 day of albiLoi.ote. , 19 , personally appeared the above named, and acknowledged the foregoing instrument to be their voluntary act and deed. 4 X4t' ,�,, , w�i /,/f4rr l Before me: ■ }��,/p,a'. �'A « .a,«,Win. • a\�'''"a•��,k ado a��',►� r1 !'l // i d • 'b"'f,4.44(4.., � r��9.� ai �,r*we., .r�`'r 'iP� ' '�a:b'1i ' p 41117*eu ,M Notary Public f Oregon a $4 ''' My Commission expires: f 7 • �" yaX�/��n -� - pia �!''��, ��., NMI 6.4 ("' ti ' tfiftfdftCtdt 94iI7I4t ' STATE OF OREGON ) Y )ski. County of )0' 'l(,,,l Le • ) i '�1 19 personally appeared„, On this �� day a� ��Y"L��'`0 „_,,, ��r p Y PP j ■ ' the aboved naaned CI . ril., :U"p).�,i i., .......____................., and acknowledged the foregoing instrument to be their voluntary act and deed. i l.rume y , Before me;' ,,� 13.E[��y1i/6R �! (,rryy .` 4r N *%*,:,',' l •tary Pte lid for Oregon ,i, i �•,w My Comm�.nsion expires /?C t' O~'C ,4`''',..$1,•-/N-"00,1. a0, 4 $.. iiih ‘1.t.‘4 ` µ. ,�ftCt4'34rt1'� �,� � If ti T i I• I ,..»uc.,`..�.,,.T.i+.. a�„„,,,,,,,w_,..:.-wuu ,..,,,„,,. ,,,,,....,»:,,,,,, .„,.,..�,,„.. 4,•:.,,..- ,.,aw,•w•p,,.,,s..:..•:�.LwM;,. .w«+∎,∎«,∎,i....'t, .,.4,..........wi..,.wt-....—,.:«,.;w...r;:.'......—...a,.....1-4,...i+.,,:.:.:..«.14,..1.;:�..x,,, ,6iu...:,:Prisd.'...x.W,+_...,....6.,, ..r'._.... �I .M.0 ' • • • I Approved as to form this U � y , By: --17* IC' '' ---U , • City At rney - City of Tigard. . ,� , Approved as to legal description this II day of ' ,le i , , 19'ta9. ~ A , Approved this /7` "'day of ”" r 19 0/ i I I i I I I , ' j I I I I • I S I I I I I • I I � I A._ter Reccizd3:rl(g, , retutn signed copy to , I • E ✓E4 z I I F I 4 c�> x331, s w �.y r 4 „ I 1 2-I/ I ,. ry , • rzIi;, 4 , 7,Tv�Aiirt ri ''{ t� 1. 6 , '11'iz'.fi it:1°"7w„'."'"S'"",,1"^ ,3'""1'i""'•...,, ,.�y'i ,�r�.•..,q..q 011.,,,;-::,','�t.✓a"""' i :) n' �'"�h x l q rfl`Vrrt d'rat�',r��1 ,•6 ., n nF } ' "4.r,. ;, .�; ..,., ..,,_,,,... ....... ..... ....,.. .,._�....,.-+...,,. "r.,l., ti�R J. r. .r •t �.>'. ;'w r,.aJr l nrt! r.'1,}..," .i ,•�,t,. ;- .r �+' _ ter'• '.'ta•.',Y,, ', I*' ."�".. .�a. -r'Y, ,7,, Y -e� .w.< s i I .,r-y. 1 2 '�� Y,� , c }+,s fi 'nSni::l: ra' .0' 'fir' .i �'.7',�o _ ,,, ;,.h air..,,,I.,...n4, t!r,. "°�.r. ..-r �°-,d'. ,,,.. it .a.,.1. t `t 1 .rl�'`' :I.,' -t i i,t 'h,. «+-q' :.aJ' ...:+:..:' � '.Sa.' .Cwc. s.:11s..rs.o M,l,•'t tr 3" '' .r fl,l' ,e f, •"Y`' ...�3!n....+ R,.»i .wTl 1 7,4,;'• .Rs'„m^.,,..;•'...,i ,.h^ h 1 !:+'.I`r {14 -�Iti A' 1, y,! ;�, � ,� ., I 1 r, r d...•.tfh».sn:...,e�.,s°..sd3_utl,�`t.lY.�. �,. .,."�w .s °'"';^!, ."8��+ wJ.a r7� �4 W,ir t «,Fl�.v� .T,ly.e 7,. �i'�},. 7yd), ...r,� ., "v t. , ,n, '.R '+ -,„, .'L.',.eAU« ,vu.»_"'^' ,r y 'f,;,;"":C•T,t" t, _�.,w, % 't .ir7' Gtdr%' ,4^Irb:a.R'. -,, r 4 3 s,4,,,,;)r r,C :r.'%:,.• ,, t SS �+;�� .fi 'I' ,.w..,.«4,«..�}'.�: u' _ , .�r.,'�...»:-'�Y^ - t ..t a�n :�aa�.S:.A�„•k1HU1.,,1> .�r;�,�.,�ay•��+�~.n+� rt�,I-, :� ;# 4,,.1., ra a r ..�.,lu 8i. l.A. a . , -'{`rl "c T ',•,"�:; r..,, "!i^t'r„Wt,.e.w'4�i.L»,r,ea.:., ,��.'"ry rM^i � a ,'r•A '�`+ 4 `,§ � ! f rwS v 4 �,J r', .-m�" «t'�� ''L _ r,4l'II'4+ _.Y..-r-•w tt.'w`Y"lE�va~� N•,' 'I F' iti?,"Y 7 F�{ Z f q ''� � , p 'i'„,: .,",',-ci�' r r x f r_ ., ISl1`�;, 1�' �.r,iy r y�" c '�w. i 'dx� At `d , 1 ,,, :n "I y nrt°ij d'+iG'y +' !; "•1u�v};xi Irarr'r'+•Y'1�11ft',,�ry."!s,.,{ ,;f r�., ,; I ,� � r I Y•'r1."�t Y�•r" w �t,, ,1, �a5, ,t i, a�tl h�'�dl',t',' of ? 11 t ti w e+..•.k}.,µ, ',iaw, :,�• y',,,,,4' ;.I!-,t:h .`d,, h ,ir:'•{xztyt , d .5 .) A'"- 1` ,+.,•4,' {�',�Y � ";,. r !':�4.' , ',5L r!�Y ri.l.. "� �,,M..W. ,.�ti r•. }re+S'�, y'" a Fy�t „ts, ,"',k. �'? gq,nnyyi�,� ,�'?;, -a ,d. ,1 .'ri r' x•n,7, ,rP t 9.,a..:{: '!� ,r• "i'' h' .'I ',i ,,,y.''+., "t ''''.,,1, ''''n'A'firWi6l u*$i�ar. ,,, uu wr. �y�,yra1•e,,,.19 r`:• ,'Ft r r'p „ t,.., ''4 7 .J h,t r, 9, i, �•t,,Y,, ,J ,� n r.r•�. q "n 4 „yt«.t^,""•�ni,k�M^, .a w...q}r,'�yN.'r� N��M+ ^r• a��'A tr ''''i,:.:,;',,;R'Z.L-.'�f' ,nh'uh:�� r'Yr i�rt'U 1?:itj a. '� {5r': '";:i'!,'31 1.r, r"I' 'f R '{, «r-'I d f M N ` 'kt 15-'4 d "b• '�rrt 1 s5 1,'r"�Y'�,i t r- S r t � � .I'r -.„,.'1"'",„'''',":4-1,!,' t I"I',;�', � I Iq�v�iYtEr ��.F'P4'k0,:::,..,04�Crd�M( �j"a� �Y.r r"��x.,s4 rr , rdfi ~ I,-nSG ! fC t { +,+ Y e 1 r 'ti i., rrt,'I Rt yr..J... + "! r d{f, ,r r ";Y t 1 rr} .y1+2 r` t,[ t4 ,Y,+Ii , 1 ^�,(ry iut! �4r$ rs t_ C +}l 4 1 ?V {rk x +I ih t' '••:,,,t,',','„,..,,•.:'•••.1, k F'. 1 r v1± 7,Mt4uvdh''le Y c t"i l.ftb..d I'♦}Ii �{rFjAt ;r ,, } t+ltr A'11,1',f titfr,' t :r'"j'+y 1 I .a,.,:l,r ..... w.4 .4 4.:•,,...!.,:•,!...,•.;','„�.rra»,,...•:'-..'r, LI r Yyy��'r` r�.R erV,µ+'{3 i,�,w.. '�,q r.:... > JY fl '' .1, 1 ,! 10 ;.,,.J•,;a....s;...,»^ •' 1 r'fN,}t , 7� t,•yQ J d S{ b M r: w `/.y,; , �'1 6�r'"tn, r,, k �! (,;X Ir<4 s� /t,' i + � ' V ly 'S` F t'i ,i5 ti r,. -R'. •- N 'b +,r,� r lye 1 +� '1 r ' fir iro,;F,,Z,r � u{ 'Yi a 0• • l �inS�i�i �^ �t+� I r, {r� rYa999 Y 1; lrrl t ilyrlrli`s wtk"�T $"I•9 Nr , y b s ty a it rrSs�+,ii j „Y /,, f„ C,.' j r 'v' 4 t, ,rotnl rii r�l ! h C7 r ,fir f w ?r n s trh ro P riY, } ?,n )rl, r# { re. ,, r 'fi 1 t r r�f{} / Yru'rj'.�,1 , ,lJj4, W+ In?,•'.., `' } r �� '1i��Ey1 1,:,::,,,,.4 I ECh ; 4 19'. t( ° to'r8�Y t" t 1 /1''''''''' t r t°" „.+ 44 F ryl .",1,., ,,, f, r. i �' �tsv t", r + 4 r,,k r tlI"1a! 1 1,, • t. 'ja ,'14 �q,'r"n!� „�� ` (�dad#x r}},�.full.,r'lx`'b :}4 P r r V "It d t '':r. 4+°r 1i., M n'.', i,y ,-.: '`t i ,.�ra tr l n.i v r �F r;¢ 4 r t't r rl 8�*1' "• I `c r ',1 I t 11 gg C» Yi lt�` 1A A't r'f,d r :Y.• 1,7j 1 y(Y�,,yyr?�t 1 , q �:'d•.A' , 5^ , f'+ +, x r :I 41 1{t!lFilr01 y Sr, IY, �,., .. }"- 1,,tir 1+ "i r ,�,�.!cls:1 MSrt 2 .rr y t / tt9,s r '4d3 d +a t h a h er 9 I�yM Yr rl¢f,C�R th ; 1�1� ,�1t »k u&, p ,1.., f Jr,1 1i4�' )•''',i, y . ',...i, -•. p4 +�jliC,l{ y ,;t, I^ '1 I ;fJ[,1 °' {1'�',! ,{`1 D ,.v �' •4 'u l ,'�,i.v , 1Y t" I.. }, t 1 C L e rT L 1 it tC 1+; e r p 67}:'C7f' r } ^ n ,1 t ',t' ,P',".. vt K },'4",t, Ct - j[W�l 1J ,fir',"; ! d n., 'r `',d�fr t ,1,1441 1 I I ,4,;,,,4,,,,,,,,,,,,,,,,,....,4.,,,r} 61 'rl l,y L' - r} y tit? 4 J T7 , (I4j 2r I'..`�,SS�"f i f i 1d ty yIC. t -,,,,,,,,,10 fn,,•r l r f rt}r j»s"e, ,r",{ viE1•j`t'h,,}}r 7 ''-3 C�d 1'f 1 y Ir '.T + ' , t S' 1 } r ff NI S`T rV.� + ` .lt_F 4' ``fr;tifY�`r 7 r[r 'rr '}I 1, r P : , 'r','d n,i 5 ..r.r" .t,k'9 xU-wY} .A T„.t'', '.9:i 'Y' ,1! � a ` • 4t{Pll�'t! , r h .,.1. "I' n e I r'^ ry F '1 '�5" < { .'k 'I 2T+r rr"' x1 �s yt,r ,�,t r.' °"I 4 , '' ;,il" a i"','{'61 r-0. ..S b�, ! �, Fu ' r'4 `Y.t,',,r' 5fn'It ,' " C'1 r r ,Y+,; 1 th� h�t' �((({J'�' t�r 1 7r�:' _ t ,re' �i ,I'I� +,F r'a '{1 "!.d e r w ..t Y, 9`,,,al, 4 •,Y '•o.�rt'Q sa`' rti) ` I'lj ft,!4Flf�,I,,,.*r /``/■ +� t! rtt}!i r7t°�f" 4 ,�+ ". , a "I.G', A r+ l r h p r �y r ,�°ia�r t yel"'{{' 4 ';qyj 1 ,- , :< ,•,,:, , r ' 'Ps r 'V ial t ' ��'.jH"tfl , t:l• ' ,Xik {Aktt I h' r :' v';t ,1,, t(Y r' tij » �k t 7 •IY[ k.1•6+*iOYr. N I t r , ,o + !t? , +,t I ''C''.°41, 3 n:y "I ,j t rk, y,{ t., `+ Q I i 4,.;4.e A 4 d a, h •h R IIi V 1, • ! .:'i‘,'..... wi t' 1Y ({ °} 'i"{. kr '1Gp 'r {t t:r,, tyt`'r. r'. e !,,,f,,,.,,, C. �, 1:<kt Y1l,C" v.'J,+,I,i+ . ,� r a, i, Zel "yt'le yr�}r 4: f,!4,-;,;i:','i'•■?i,:',4.:',F1,,,;,.I t 5n � �Kkyw.' t •t mt " d �;r:i ?6.�6 a'l�f 'd�, }1C krA"LIf,'t 1!P;" 11 t,,}.. ,4 ',...ii.c .,? , r LY v r ,1' , � �'ryt,'. .,,0 a t"d9,r, r!* !'tie .8"AF? •i' &'3t (4,.)"d" 1. ra I r T•r }r :,Nt��r1' , v' '•;',.:1..:,1r , �"�.' Y r4 'a'e`f c•, / a ;'ir't' ,,� 1 I. w 91,,,''' ,„ ' n ¢'i r'_ A,.dy * rf dht„4 F!ra dLrr,IH'o1'. .r� id r{;4 y + ,a„ ;1(1,:+- ,.-P..f'-�.. , 16 �y , 7Nt'"a:w , 4�1 f •rr ,e ry r SD}t r,,f+tf C t �t� 44 k t !Mt t Y{1r , + r ., .r 0 y " l V +� �„ �,d' '�.rJ, (�Y d�� 'T r1^fY X ,�i ,�S "', aj yV !,t.,, ro �n r.'-ew?e Wt F sw d 6>, "fit a} ; �' l tx i l rfl Yl +{ �y • I••"�`f Yf;k+�• 14 t y R ' -'r, r � A r l "1 r"rr h .v,ti$tt4{+4 k,4 Jb, ,,YyvjS„ 1.15'v . x1��7� K��ili 'i,pTil ,rfF,}r 1` 4 ,, " + « !C, . '4+, f",,,; Yt, ',. ,yl '�f ,y,t Qdrr b'r '4 W 1[+�?"F�'�N1ti i5`i A t .Y ii r"F +to 't:'j ,. ,• a■r- . N. ,, ,tom{. S "1 r,{}A'+lr YlM`5',C r, f�',T,a+,=XA n 't S l i d, w C r r. t'1 ;f , ,�r { ]rt+ i I to Sy ( , ➢n, 1.•r 'IrrAw" i it r"''Iiofh I t "nrt" ,4l 7'�t Y �a AV�1'S „y, - F 1 r E,_f , i,L L" ,, .,'Sr4 y I 1 r ,y 4H t t tr 4 t«Y"0.'i PPP r r a:l wx "S'^,. 1 a2,' in rre° `SCI ^i. k 0 rf "If 1 ,p n ''" ��''n _ I ` y" L„ h! �v 8�„Ati d' Y�,$,i � Na r r yt 9i r t P ' . � ,„ `I I A.r{ "I I Ir+7 k'df„1'A,+ ,.N" IS*p t. }r,I.4•+y,• �' . { rr q�••••.1 rs.,w3r i-r f, r?•••4 !, •.,t i, d�l% , to Y„-, 4,1 {{r,+�. , ( t4i{,y'"h"GA 1t kOAl y: o"1!N,r,�},,,,,',,,,,,,,i-1,' + n T,,,'‘,"1-J.'",'''l �4nA; , J f fl Y' }'.4`�;Mai EAfN�tl , - 1 '1,n S' 1 {+ Yi 'ly tt,,Yllrfl �r, 1 4 A t �, _ rR t!' •Q Ail.' tr}'0 r,i'' ;', 5atr F:I'a t, Yt4�Sr ' Y,, 4 , 't 'c o . .., a , i:t.l ,T+ +k ftr + t ! , y,_, �, Ott j'rtrr is { Yr, vA� , a. r. rG, 5 A ,r t '', ;+r r J4 tn, AFI +.t,' YY iy aYx• 1 Y r 5 u + n }ll.lf ,v�i yj vl y� 4 ..n I�, a,,, '.y t t'+.A 5 t .I Y•r�«�t 1 y}�t,$1 e F';'1..-Br +f 4"{3'r� Yr• II S j'1 v.1r { N I�,�'''Rif{, n s:rvhf'�J�d»I�'rf X I 1 ,yi At Y�,�'71 A t '�. I F u f 1.r :I '.I r t t ,. t't +v d,t p+ v. f a , ., ,n. ?R v+ 4P },`,. r 1 n h r r4 M rtt"t,1ra '4"47 •r r i +t'p�� r. '�r� 4 a �" .Y" �. t f�tfrh;t 't I V a t S'} � ' l ro4 dr r ,t !`, ,a'1 �� t tatAV 4, lP I;* ,+ hp t,,fir .• n I ti �C,,�,q r,:r5 k -a ka t " t I''„ , w w'� , ,, �, n k"'Y~ I S r$•+'r T f{Y r :{,a p,'•t. '1rlr"r"�j.rk vk •1,', "iw' „ 1,,. ,«,rr " �'1,,a: .al° Jl l{-"rJ ,.'',t,' ,- ' -M'' ' :. r r; ,S'1 1: lr' , "�','Y1'J�.-1' ar '' i i t`,t 'f t 1 ',,i' i;'.'„?';''',.",',. r a s - , s f j iul�l, ''':,/,!,,'";',.. ,, h Ira,. I s ,. , ,, �I,-' {. 1ii He �I it�`,�' !t r'•t<,!, I„; 1 {y S r .a Is} ' 1� +* I t, ? I C., .I'' 1 : tl +� f n�', of + 11-,'� YE yk t I tiI� a S Lt ,r ri!1 I , ,Y- i ,yr . r.c u 1 4 Y p' u i d,., :,rt.al.nr, iu.,C'xrl„ri 4�} „,!), ,t, r' iIJ'eS,.�A .y`t, rr 'jr i,r1.4ty+IYr'�t�{ �' t t F�'' ! ,..., 1,■ ,..,n r.',. IY, i, X i:r' i`i e d:1,' . ro„ �, 1 t,I „4.' �� y, 1 , ,+A , ,t,r,�+t. f. d ,f •r•r 1 r c ,, "' ` ' '' . a 1. 1 ••• 7,;''112 A pr t '"1t s : �:• '4 i ',,,, 4,,,,-.4,4,1 a>,'1 1 ! nr ,, r7F : < .�( ,'+' . ,. rQ " ( ,, +t - .,ta.k:, , , 5"rSS,Y ,1 .?','''."4-,,, I yr1 _ , e ro' +J,''''1,' ,4 •«! r� ! "a r.,t., r j',�,:: Y ,fir W rY a k'. ,y ru■+! ,�1 , 1)�ve 'i. f 1 1-" A('''3 E r Y,0Nt.E`}d l'. I lugs-"tl_ C a r' a 1 3 �� f a ,, "11j a' + +, F..t�,tµ -YG''S 1, ' ' c ,9Y4utYl,,,t:Yl�f r1'{' t 'ih, ,a ;' , i t i'I .9�; r ,r �,;?�r et7' :','1"--, 1 �� ',-,,I.i,S;�°.'tl a� n',:;�. ' t"r„3`3,�' «I! '�6. :''I, elw "p ..�' h,4 , t. re. "3 ,, '''f''3 v ,,,y: F ,'�, r t' 4y! t a '+t' 4' I '<k a G;Ire"�3'3G �d `9'',�6 v, t r I �, + #kr•5 �,.y�,4J Kqy<,{Y�r• 4",,.,1 ' ,�, r,' t I,t. ,.,>, ,,nn ra, s i 5 „+'-,r r dd{{�n{� °iIA'r r "r.t 1, ,, 41.,,:,` y }tr fl3!,. ,ln 4' .'1 I, ,'I'�, 4`i,t'.- F `au F, I, i".,q r 9. i L,Y`1£. C.;�" l ' ,i{I'n Q- !•, f a p ,�+LA.,F I�„ tw,try, �','{�t,.t � . `, R . &v' ,�.l'',1,00/''.,' A , ,',a is a,1' y'd?I ,'ti�" 1. Y f Al, 1,:12 t:tn«Ar'1 A.4.111,,,5 :�,�, '.s ]a uk`,:.,B�.0 tl..:� " -f tl'•1 j tty tr'n,e,r ,.. ,7,i',.1,, ,,' . 4,;',4 lt 1, t•rj I f n "1dr`y,a ,'« ,I,grl'r,,s,n 'v ,-i,L I ." ,# 'Rn y S ''r k1 ' !. ,;' . 'a^'II "u ,'17` d R'a C,4 c 7, P�G�t t h+ t rue � �r1�1' •gee d J " C t t j, ! t d `,'4 , ,41+;,•tN l�l r ....l Y r,:;.°u F t' ',',`.",t,. F f S"L r• r 1 , r S ,';'''1,,,,:;') {Y j t +,,s It lt!'f"�i1r II � ' h -',At � I F?,, �?fir Id f,§!'tql aµ+n v��ivl"'ir4� it f C"`x 4„qtr Gt ;Ilk 3 a v+ 4 11 }4,,,,',,t, tt tr Y ' r Ih 1 Y A r �� f +ltt Ift t �'.n'1„.'.,ixCCi'i„w..3.` ...t r, ,; i rr! y it a e t, ¢� �r , t r5dl• S )rq Y 4r'S„' . InSt ,..,:.;,4 1;,yi`1 A+r V n1+ "+ J��+ �r3 I� ,rY, 11 1 v }�y %�St,.9',tYtf ' l9'�."1t4C i i 4'4 l' 15 t,Z.l'.'"eir C,1 1'a.t.e 4;,,:1 s.+"..{ . 4,i , ^,Tttt b �.t r�i ,rl e{It ,iii:I ie!,).,J1 0.11,47 i,Fd IE'{„'�.v`.Q c»it�,<i1t$el(e,;-, i:a N," r:11,;,t v� y,yu t f_ t I,7,X, r ,r '1.P,,0I I' U"a',:,iu t•I,1 1„"},,;-I V;�1V1,'4' ,10<in1Y t7'y'c',..,•1,1••,4 1;,r4 ,;4'gl* ,7 .t.,,,,,'H,,,,.. f' ' h �4 A w• r w,C, o"S }',: ^ E"M.'t'a a c r,, rvt.rr� n'•' 4•,n3A'. 4 -,f, r>d�, tY tr.,'.','., , .7 rho I 1 lA lln."rr "': "i C W,r,mx.� k h``k r Jl i '� t°..,:Y 1, f,P. ET?Y.7 ..t{yl „ C r 7'e',,,' 'l v �r ' TV r ,',1r.'" .1'.x ,1 Crelx l ' , '' i d Yr�,-5�' i r,� rk!a , ,rr w ," r ? ' rj y, 1' +idly{' %�N �y�r .} If:,tt, "a d'Mt l.'.i,w.11.r""' (,a, .t «,, G.r °vii,, 5 , , , 1,,A,,;,,:,,i,,.lu�' t r {5 C 9 1 rw (Ur w+1tt 14 r�'1,I .10,a E Y wl`'R f,f . . .e n r s, ctil , F f,�.rt„ 5,Y77f' fl fr Y « , #�t 1 .„,rrt a�Y I'ry�yJ { • y s I � y Y *�•aC ,', w'�,gty •�, „,•.,,.t ,: n 6k F Ir ' ti,,j J+t�� C ��VVV�'4Y•`4l t° , r i ,tv r.x,F ` x 9 , } ,r, ayYn�t i d ,b r f'jl,",+' 1 +, '� 4'.. r ` . "r`l 1, ta+ F( qrF,., £ }a�`? bq ll'a Cq Y Plxt° r rt;F ;' 7 ti 'i} C( µ k q I aA b. ,1p f N f ti I r.I +• � +1 rr(r$ 1 1. �� I r:tt. 'r .,,,.v.�1 ,ua,'.,.,p„w'r.r.n..Y,..�«,.�,..1 ,+,_�.,.1 wi'•t're= f",w,r"'S,.,ww•,,,,,.' ,"',W,. .' t, ,t,•Y,r' 1,,r '% ';' ,a "qtp , ' { ,. ,t�•N ,jY!1. ......... ....:v.,..... .,..,".,..,,..-..,.,, .•»y..., ,yh".: w-., .,,.r' ', r/,., ,n i,,,,,..,,•,•,',!.,i.''�.�„�'',,7,�`r .`.t<:Yh "d » .rle.*II'��t'';a.Q ..,i• y- ,�{ r,l„ 4 . c ^ tr f.. F' .,} '� i�,,.G1RT'' "Y?'cdl• . t',''•., , ';',.',,l';'', tkY'�'r 'aI ,' 1 r, , I, , i rt ''ltn,`t � t ,a At ;{ 6.. � k t . ' t•..Y.. r frl - ., , �IS4-,A{ t `Y,.'x? .1' 4 y 11',',A )'' vt,,f. I -i';` FJ. _ I! _ k r �' ' ,,r, +1,'t'ti 5i4 I a. � e it j' I' t , ,! .t r 're ., a A ,i1, I ,i, t, N I .r..p .+k n,Yrt�y'�,. I yt ,t' .Y bl.. 1 4 '�I, �.I fq, I 'i I �, r�, �Y 1 4. 'I' ! J I r, �:,, 0.a"'F ! y� . ry"' �{{ :�i 9"t i 0 .1- .1.,71', ,!nrr'.• j� kr l.r" i ",, }, i1 it ` 1 !' , f'j6:. r k ., w r ,t „e'' '''rt„; ;- 'I S';.•+ �', t', A , , i' ' - •'.;p 1i, r .I� I ..s sl F.+r,;�, :7 A t,c!' M1' ,,(l•,... 7,;',4,,,^,,,,11 � Yt.y 1 ', 'i Sr ,;1. - - s . �I ,r. {, ,y., t,,Y'J t r.,k,. �4'.'i t l'' .. ', I iii''f, ',,',`✓ ep:' , ,1 { �1 + ,I ' 1 r 4 I i '� 'r..' 4I' i, ¢ f ' r" t': ., , r , , l�', < ;.',"7'1,,;'�d�' t R,- ,�,. �'��'� , ''�.' ry� ,'t r, ,� ;11',.!';''',.. 91 t ,' ,',1'}C _ , 1i G;i4. ,s- "d1 i `i,, r',rF a '�':"it«'', ,rte :t� "1. ,, .r ,I -if I r rlh IYIJ{ 1 "I +,�, .yy,�, -r;:4. rt .,y.� � �I I ,+ ,��((•'' � r'',....•47,-,{,.,1,Y ah, .,br rlt , �* trG$" I. 7•";,- " ''"Y like't t,r rt x' ;, '.I rh 0. � 1ni 5� 1�, le r.:{: ",,44''''''s-,'r«'� t�'S � i r l } ,',I' � ari I. tLrr r .;w 5 1 9�� - I i! J))) re,� ,. I . ,�. �w.jt` ,,;1 r d!� 1,:,' 4. ,n .,,.t'7.7,"•',,,,,,,•,...,•;„ ,,,„4.' w Iqr :ti. 7 rC ! 11. ,i', x ,kh'' ', t-9 ,,� •I.^" -...:1,,•,1 .,' .h .'IS„'.f, „ , , '+„ : ,: I t1, '.b, - M„ '?. •:1 a ,• r � ',x�� ;'I nl '.�w 4 ,.I a�'� h "I r 1 f IF' .I; ',.'�, T ��I•" .1'f';?hj 'f 14'r' ,r R7"Q,W�' • , {I l r *.'k , / l•: (4 14 i;' ,s:X �.- 'YY ' • ,r, r, _ 'i +, y M`!.'I. I I.' •:11;•`,•-, 1 +.rt 1 „ r 4. :,i, �. ; .t ,, 445 as,: ',s 2 it fr< ;;F A t :'� A','''''' PV^"K 1. E: yn ',,4�1 �+w 'I ''';,,S;.,'''''''';','!"' ,n ,1.� n�'� '„�. �Y, r, , pv,?, � rG t xr;l ,1 ,'' .," , .,;•.,, I I,'' 'A ;;,;,, I ,,' ,h. •.;."' 4, A' ., k•7 4'.',Z' " .w�rrY iM r"'` aly'�,�.,'M:r ',,4.•R :t"".-7,,•i,'; � 'r4 � Y' , A! ` ,: �._4l �, , �;ly ' 'V:_ sw +,.`r 47,,. ��, i, ,k �rw 4d t +l'.'' 'h,�` Glr , •+4 1 ,i:'�16 'F ' ;.;n r. I r•rf'•5'kIJ. I M „1 ^ ✓3'. ,.' °r '1, , «rl.E tl A r l.n d 5 p rµ +I ,,I ','.,Pti "I w h '.., '„• , v . t ff )i as .:t, ,-,11tl.nr+.,, ., r -, 'I' •-,,,,,,,l'.,, h�Ca Yr.,,,,,,ii,-r "' , ,W5 Il'- {� r. ri° 4 1C ,µ+ :Ir 1� r { 1 A y Y .- ,&,..,...t1,,•,..„1.:,,,„...., f • 4.•...''''';'''.'''''''''' it a ,r , j ' , 4 • r �,,`! 3,,t1. I ,;e''iny,}1r�r^,,.r.: t ,ir. , t ?!Ar�kt,� ,;+`+`1 nlAY.�u„}I';:'11.'''''Y,+" r {+ 4 5 tcYs':, t .n: r';'t t n , r .•, a } ,ti 5 ,I M 'I.;i I R;I + :.:,i'''''''4.to Ia iC{, Cr1'�{ , rr 4 r,, Ci �', t , '531 rq{.� �.t' Filet l,, :r Af It R 4 it , t/r. r'""ri,,'"T .M':,•ti'd�"'{ ^fxl>li},,,.7 ,l t,c'.'i> t, s t. ' ';+ eY D r:','''';11' _ , t r , ,, t I�,,t l +" rt 4 b{g5�1,�,,1 rr!��, , li':`� t +I yt, ., '' i RIOh `I •''S .' �i r. ,. .'� 1 r! r , �,! ( !( C r�:d! t :'''::•':,:":',1';',i�,Ixj+...C� } +,5i. 7 tt M t "t, i, d ,': Ii "r .l iy f"',..'4:.,'''' , d,1{1 s4 y ..r,,3/',x+ 5ll1�tW,i l a. 'F +r' ,' x r0.. r* , „•p + „ rj +J} i, ,iM ;'..W.al 4 ,,r,,' 4'' ^t "J i, It V e :h'. C,,r !.h i'f t,1 T f :Y ,i }..` t Av vF- Y�i��I� ...-U, u.+ ' '-'.---'!"".'R,I'..I..,"r=r'"---,.L:.-L,,..- , r.�i,r.,,.n.:....arr,-0....,..',+.«C'eku+�•r.r,:.•, �t..,jr.,,!,�w3'. .;; :t. « . , . . , . . . . , .. . , . , , ' ' .4, ■ • • , .. . . ' • . ,, 4, . , ,. , , , „ . , r.. , . • ..• • . ,• , . . . „ . , . .. , . . . . • • -.■ , ,.., ., Il I' ' . ., . , 1, . , . ,..,1 )..., 0, JV I 1 0 # . ........cz. ,i • . . .2:. # . . .. x # .• . . , C...0, P` # 9 „ . ..Z s s , s . , I , .. s • I . ,. I I pi I . . . . .. . Po . . , , . s • / , . .1 . . , s , 2 , . of , e , 9, ,. e 0.' . . '\ ,• s .c.,? ,, , . . . es' a' 400 ' 6?,`■„ • • ' 01 ''..'",..........,....„ # '`',...*'•-•,,„, ' • . • C.....5"...' ' ..'t. 500 . 434c, - '4'4:0.-;;••••%-',......, ''''''''''''" , • _, .... . . ,..,--4 •,+ ,.:-. ,o - --- „L . . • ...„,....,„ ...... ie , , . .. s 1 2 54 7 3) .. ## # , . # ,•1 1:20/d..4 --- 0, ,id , . , C S 3557) .r 16 ,984c, r . r • . ' . 0 w , . 8 .d. . . .. e 0 : ' i'2 ' '. • # r2 A r , M „, . .• J ,r-1, — — _ 1 tio , . . g. . ,... 0 . .. •-121-1ASE 15) • . • • SU • . , • the9052'w 321.28) (2000). , . • pf , 4 0,, , , , 700 .............. I ' , • 4,55,4 c. . (CS 15,9 '?) , 40 STATE 00 QI1EGON } .. •. g ' , SS dbuhly at Weehlholeh . , , L .•- ,'._.,.._._ (PHI, beheld W.MaaOn.birect01.0('AnSbaarriOtit r . ' . . , . , end TaxEttion and,r0.01161oAtiterdet a Ceti, ., veyances tot-taalit40u00p,11161,q,0 cetillY that the AthIn Iffeirtehtint.:,,,et.tiyhtti-10..tios retleivod , and t000tdad 1,64.1tigkiati...tiap00412112444 dolitity, , . , 6 , ,t:-. ,,,,,,1 ', '';',-:,1' ' I• , , ,,( ,,,(AT4tlaik:V.kOliiki0gbleecielt-ur , ,:',.., ''"1., 1rA'aleitip-iteAtA:IX!ait,f3n, x- 'ir t , ' DO CI '1 89017696 . ' •. i .'!, ' ' . ' . • " Rect: 334 1 '36,,00 04/21/199 11452:292V4 . , ' , • • . . • .� i. , - 1 I } ..,�a..+wt a ._..........._.w-,..-_, a.w,....u.....M_....r... ,:......,,..., ...,».............,..... .,.,-.-......r ...... .,.,.,.,u.,..,,i .......,.mi r..a t Mn„c a°„ 4,.'' ' AFFIDAVIT OF MU.ILI.NC STATE OF OREGON . County of Washington ) ss City Tigard l' . - * / • h // -,/f" , .being first duly swrorn, oa oath depose r a c_. • y: Please Print ..�.._.,.. i. • That I am aN '4 - i for The City of Tigard, Oregon. • That I served NOTICE OF PUBLIC HEARING for: K That I served NOTICE OF DECISION fore 1 P Director . . City of Tigard i Tigard Hearings Officer I igard,City COUXL l A copy (Public Nearing WoUice/Notice of Decision) of which i ttl;.ached ( "r . B .bit "A"n mailed .to each named persons at the address shot on the attached,•i3st narked exhibit "V on the. • day of A /, 4Z x.98 j . ' • . ..•.,v.,��.1....�.. .tee....., e d notice NOTICE OF •DECICXON- es hereto at tach ed, was posted on an ' • .appropriate bulletin board on the �1� day of _ 1.4Led ,� ,19 ,; , .. States �}.1- 1 r-1/67 a ....terra. M Ylfltll• .and deposited o .rr�.u"wr . . IA the United Stan � �-,e day of `�" � 1.95.E postage prep,ild. ,,„..,-.) o .1 t.■ t . / /' / H, .�.: �_" , 1 'gamma ostCd 011 #4-107...... —r� L1C '-"- `Si;, tut P • tin bard /4„,/' (Pot Decision �O. y) 4-19/„1,6 /,‹) 1 ,, , Verson who delivered,. to PQST OFF E ? glibber ,1,5' .r .. Se. i x w� , n off. t� before tie oa the day of 'Ado:, � 19g fi • «, �I 1 is.ea y � ,fir""�„. ” a a y r w, d I P'� ■ t' `' w . ""Y A 5, AMU r∎co''at� r'urry,4 y,a �� /�f■ 1, yV�• .inµ,V r ..1f,11t' ,�'V' �+' t r IdUBJ.r C ' y_,/,/�',i�� W Novi-. Ill 1 ii' ° My Commids&on Expires: 025/P/0021 1, q \ r ralrimplumpliiiiiiiiilismomium.........ingimmimmniumila11111011111111F .- - ,, . . - ter_... .. b , F. w , 1 • } i i'. AFFIDAVIT OF t4 IG3,NG i STATE OF OREGON ) County of Washington. ) ss. 1 IO -- ,, /! A . , , -being f rat duly 8F,J'1',-a, on oath depose ...Rr<, 4 , ' • and say; '.Please Pr nt:1, , N. , ' , . r- ,./ . That x am a . �' : , s for The O T r i �of Tigard, , ( ' r .4. � � m egon f y.'ltnt I s.rved NOTICE OF I'BLIC REARING for: That I .served NOTICE OF DECISION tor: (,. , '• ,' City of Tigard Planning Director • .t . Ti and P Commission �... .Tigard Hear Officer 1 -Tigard.,City Council co (Public H'eari Notice/Notice of,D t •' ��, P�' eciraiona of ,which '3o atCachod (N+arked ..'r, r ,, . , Exhibit �"e) was raose At the ,asi4rei� shown oa the wailed to each' named attached.hut' narked eratbit °'B° .on the daay. of f °'# .,..` 198 said NOTICE OF •DBCICION a" a hereto' attached, was posted on an . ,,' appropriate bulletin board on the ini L day of . , 19 and deposited tee K 1 on t e� in the, United Stated' the �..� day o� �� ; 198.e.,' postage 'Prepaid« : , P Si. . e=ao> who no ted oa Bulletin board tnt:i 1�, "' ✓ d✓ ' Oho �iCrflOYt de].iVer ed to FO T gI S F Gg d, . day of ,�, ,� 1.98 ,» 5>i>ttiatr�cbed aen swsro to� be o r sS ��,rj:�° 9 i el ee • , ' ' >1 1 '• '''/ / ,,e .- , ,, i . ,' , , l . r N May' oramfss on Exit . r A2a7p/OO2ip ti h , . r , , \ • • • NOTICE OF PUBLIC HEARING NOTICE IS HEREBY GIVEN THAT THE TIGARD PLANNING COMMISSION, AT ITS MEETING ON TUESDAY, JULY 5, 1988, AT 7:30 P.M. , IN THE TOWN HALL OF THE TIGARD CIVIC CENTER, 13125 SW HALL BLVD. , TIGARD, OREGON, WILL CONSIDER THE FOLLOWING APPLICATION: FILE NO. : PD 88-03, SDR 88-13 NPO # 6 FILE TILE: Hector's Nursery APPLICANT: Carl Hector OWNER: Same I` Hector's Nursery 15300 SW Pacific Hwy Tigard, OR 97224 t for Site Development Review approval to construct a new REQUEST: A request� retail nursery building and remodel an existing house into a retail shop. Zoning: C-G (PD) (General Commercial, Planted Development overlay) . LOCATION: 15300 SW Pacific Highway (WCTM 251. 10DB, Tax Lot 500). (See Map On Reverse Side) I. THE PUBLIC HEARING ON THIS MATTER WILL BE CONDUCTED IN ACCORDANCE WITH THE • 1 RULES OF CHAPTER 18.32 OF THE COMMUNITY DEVELOPMENT CODE AND RULES OP PROCEDURE ADOPTED BY THE COUNCIL AND AVAILABLE AT CITY HALL, OR RULES OF PROCEDURE SET FORTH IN CHAPTER 18.30. ANY PERSONS HAVING INTEREST IN THIS MATTER MAY ATTEND AND BE HEARD, OR TESTIMONY MAY BE SUBMITTED IN WRITING TO BE + ' ENTERED INTO THE RECORD OF THE INITIAL HEARING, FOR FURTHER INFORMATION PLEASE CONTACT THE PLANNING DEPARTMENT AT 639-4171. TIGARD , NEIGHBORHOOD PLANNING CITY HALL 1312 SW HALL BLVD. OR CONTACT YOUR ORGANIZATION (NPO) # 6 Chairperson: Phil Pasteris Phone Number: 639-9740 , fit/5 C F20D • . '46,tj,s/::),774, .h'07 :: f,. ''' ,..„„) ,,,, dok • ilassi.....( 4. E - ..-.„ . •,...,..,,,,,4 A.., , ,,e SO 411W; al 'I r . .i.„ - 1 .,it_ ,.w. aoll, t 7_...�-1 1 / 4, -., , A. • ■ o',0‘ ,i, - . *� 4. W IrFIR IAVCN r �` �� 3� r +�L+ ' ■ as �'�.. y,�,4 �.► .r 4,s ronz a ,� a • F, ./,` . yy, st • 'a. 00 /AdRN AVE P. WAY O ', ' l fI ' rirrrr rrr N nt ■di i• a 11111 14,, 4,6V+ } 2 i � I H ,• as ~�;s- S.W.rtAROEta P�N 1; l ■ B.W. � 2 �a IJ* hT ! a (MAN* t:r- / 04 ' sQ 1jIiiIg\I �..0 v. ft�r I R!i:iE: S 111115 ISA M ...LA. CCU I 1. �r VI EW 4 VIEW S,W ' saa o Cq4 , .,,•c ,®� ® , O ��fp�4 a S W ��—film"ill% -' ° x'11 0. s :,w,�' wILU'w.`n, LAti-_ o Ajjr.� 41, rrl s., , W El n a 5 JAIN .. . EINW ' ' ' — '' ( MURnO'K.. ,, 5.W. . ----� as iX —I ❑O v n al .atom I ` d L d,7p a i-i-.. . - -------M-' limo , " . a e i!R!Pr _ rT , l !� ' ____A I r . .i.„,„ ';" 0 3;4.' # !.., r''''.‹, II *1111 •Sie ��" 3 Sop. ®®. KAY LE — illisig-sarni ■ Ims ',' '/ ifi., / iiii, InotLAM C� ------- ° .�`' ., � , '4� �� .r. / !�� 1.MI1II 3 ��p� nit �. '� s�� `�,„1- • It , g s;�^ '��`I",' MO fit/ VV ,��t;,, ��a.ik t At ILLO0 r e ‹,00,,, u 1St 1 1 It 1 ra' ' " C\ t.' 4,,,-.2.-\,'",-,-* 4 4k li MI To e ' $ e Fl t ,,,:,...L... _____,,v .alip- cl...s.1\-\,50.i.....-\ Nir 1 t; 0 , a p--. FIH.E PNG,LIP ul , '"e, f� �,. C a'„,c''t ry{ E un r p p4~ el ,w�(„ ,,„:„.......,.........T.---- 1.W. r ■e At �� r� , y 0,,,,,+,:::;* „+i t x r, ma i a Slit 1 at 1 CE ad all ms I Mir r . _ _w ':-.' W ` ” Si . :: vi w • •• ,' i ." .hut rr �. _ t °: 'I alts cr. , • '� • .... t, . '4■ PI0, r Ut „ kElMt �' J /0 lu Ill � r ,,.. t t +� � , AVE. $ i r.ti '- r qt spt. .•,...; tz, III 1 i i-----L1 ____I I yy� II ,M 11111 t . 4 . 1 ,y a� '�, to I •huu� • - Vim\ • ,^ ... o . Carl Hector 2S1 10DB 200 ;15300.SW Pacific Highway (- William Sanders Tigard, Or 97223 2 3256 Bents Rd NE .:�. 23256 ..�. Aurora, OR 97002 ti • PHILLIP PASTERIS 400 8935 SW PINEBROOK ST. Robert Luton : ° TIGARD, OR 97224 15300 SW 116th' • Tigard, OR 97223 ROBERT EBERT DESIGNS 600 Rmy 532 THE GALLERIA Martha Jane Roemer ° 921 SW Morrison 15430 SW pacific I Portland, OR 9 7.4?05 Tigard, OR 97223 2S1 10CA 102 700 , City of Ring city Ida Kielhorn 15390 SW 116th 9005 NW Cornell Rd King City, OR 9722 4 Portland, OR 97229 d' 90079'„ 100 Angelyn McBee Elbert ,Cushman li 15290 SW Crown #3 c/o MDSInvestment Inc Ring City, OR 97224 1400 USIBancorp Tower 111 SW 5th Ave Portland d OR 97204 0080 a , bra d.nces Lund 15290 SW Crown Dr. #3 King City, OR 97224 I y fI 1I 90081 Hayden Corporation 900 N. Tomahawk Island Dr. Portland, OR 97217 ,A 1 90082 James Davis Life Estate 11505 SW Terra Linda Beaverr_on, OR 97005. 90083 Martha Eoughtoi 15290 SW Crown Dr` #4. King City, OR 97223 • 90084 David Reset 7928 SW 5th Ave Portland; OR 97219 9000 Rin Condo . 9 City Unit�. Owners by Tualatin Development , ' 15300 SW 116th Ave A Tigard, OR y7.22.41 , � J�.nk � Ate,. - • ' • REQUEST FOR COMMENTS TO: mei Z DATE: June 15, 1988 FROM: Tigard Planning Department . RE. PD 88W0� SD RSSl 3 � �e cu e st for r Site n evelpmen� .L3emi,,e.W approval to .c,catastruct _a new nursery buildin and remodel an xia i G o laat: in n i rcl-aLL shop. Zoning: C-G (PD) General Commercia, Planne. w .•u . 0, Y 15300 SW Pacific Hwy. (WCTM 2S1 10DB, Tax Lot 500)___ Attached is the Site Plan and applicant's statement for your review. From information supplied by various departments and agencies and from other information available to our staff, ` a report and recommendation will be a' prepared and a decision will, be rendered on the proposal in the near future. • If yoiu wish to comment on this application, we need your comments by June 24 19 88 _. You may use the space provided below or attach a separate letter-to return your comments. 1 If you are unable to respond above date, please phone d b the p the staff 'contact noted below with your comments and confirm r comments in writing As soon as possible. If you have any questions regarding this matter, contact the Tigard Planning Department, P.O. Box 23397, 13125 SW Hall Blvd. , Tigard, OR 97223. Phone: 639 -4171s STAFF CONTACT:, Jerry Offer ', PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: We have reviewed the proposal and have no objections to it. Please contact of our office. Please refer to the enclosed letter. Written Comments: • Name of Person Commenting: Phone Noy eft/3 )21P u; NOTIFICATION LIST.FOR ALL APPLICATIONS G::' 1. PO No. �r, CPO No. P . per 2. CITY DEPARTMENTS . � Building, Inspecto / rad R. Parks, & Recreation Board/Curti S. ' ' ' � ":, . , City Recorder Police ' ..~.,!igineering/Cary A. Other , • 3. SPECIAL DISTRICTS • Fire District School Dist.. No. 48, (Beavie�rton) „ , , ,..._._' (pick-up box bldg.) Joy - : H : : , . Jo Pahl ..- PQ Box ; 00 ,, . , igard W.D. Beav'erton,' OR 97075 aI. 8841 SW Commercial School Dist. 'No. 23J (Tigard) ?, _. Tigard, OR. 97223 ' 13137 SW Pacific Hwy. Tigard, O,R '97223 • , Metzger W.D': . ;Other AFFECTED JURISDICTIONS Wash. Co. Land USe & Transp. Boundary Commission ,: 150 N. First Ave. 320 SW:Stark Rey „m 530 � ,. . Hillaboro, OR 97124 Hillsboro, OR 971;24' Brent Curtis l e'rin Martin _._.,...<.. METRO Paula Calvin 2000 SW 1st Awe o •,, "_ Portland, OR. 9720 :- 5398 City of Beaverton Jim n Hendryx PO :pox 4755 -- 4755 SW Griffith ' Beaverton, OR 97076 . M,s 1 ' �� Other State Division .._ �. . Gunderson . ' PG Bok 565 , Beaverton; OR 97075 7; SPECIAL Ac�Nct�5 eneral Tele hone : - • °�'G� �p, � Pottaand General Electric : Ed Wllmott, Jim iohnson 20 9di7n Portland General E1ectr e, f XTig6ard S;W OR a 223 14655 SW Old, Scholle P eery . , Beavertoi , OR 97007 I 1 Gas Metro�;�o1itan Area Cbmmnxiicatioh `.�"�- �N�orthWest Nature�� P a„ Ron-aid-1)i Po'ivi PE; PLS TW ,tt Oahe lechnolog y Center ' . 20 Second Ave. . 0,20, , 22 1815 NW .69th PLaee i S-6 Portland, OR 97209 Beaverton, �,OR 97006 4886 West I 'Pacific Northwest B ell :Other • (0257P/0021P) I R-3/87) • ” • • . l ' .,.gA�ii:i.iy.,+r.,�.l.... ...,_•w—........LLU... l .••,r„11 v'er ..........r..r.aa.tA..._....«.-.........�.4.,..aswas, w,v.xx,„ .. ..,. ... .....a.,........,u...,.I44.v.e+aY+n....Mw..•r....,w.,....,.t.. uirl..r lJ..+,«.I,rS.:x.�AL•.+�NM.A�I+W-'' '•.,---•'' . .x 1'''''''''—'". w...-( • , �•nhiF,,n...arif+,.a6 by..A,.Ikb'•' -0r, r�r; fA� y . w ' 1j.' , ■ ' 13125 SW Hall BIVd, � . ;:1 P.0, Box 23397 • ' r ! ;4t, Tigard,Oregon 9 722 3 r 5^ r i.y . 7�S ' • ' „ ,4'p , + ;ate ci;to IT:'''',01,.* ow, . , -,.-,..‘,., _ ' 400 , • 0, ,,....Te,1,..,„, 4 ' i y' 4rG• 40. • `/ w ', Robert LLi,ton `:..1:0',,,!,c(' ,, , • t,'''°4ch,,,:;10,),,,• , $ �rd 1500 �SGd'116- ,te ■ • �. r �, `7223 • • • • • • pp yy I�EIiE4tb �rii 6yEE {e� 4 !E! 1 1 �E 9 { / 9000 ��, a + yf : • r y . Ring City Condo . ,; ' , °_' UZ 1 °VT1 l t er 4/+1.0 0 s oY TL7a1 Tualatin A d Y530 SGV 116th Ave evel;apne�1t �, Tiga.rd� oR 972 • • • • pp 1 1 • 4 ,ot , . 3. ►: 90083 1 1 Martha Pc�ugh'c�n 15290 SW r ,-,-.own i L 1 1 1 ' �ing Ciry pR X7223 • t IEiEtitltl!lEi�t�E� ltpE1 4EE�Efw'. 1 Etiki �@ii�dlllEtiiS�tE�lCdi!'t'' , i i • • • d • • j 1 1 it'd r e y rt e ..."1, ev ^ ... ;��'..,.,...�..,.a.Mr.,..,,,.,�,. ',.—...:r*rir�a' '^4rc�yy»,:,__n.....•...,_,a+.',....,.'_�a,...,.....�....... ......... f._ ,,,�,,.,w ..:,�.f..,,... .� .A.. ,.k•,..,w..-...n,... ....» �,,Y.a.. ...z':,..-,w-..f.-..� M.«a.,.. ..d,� ,�tut,.SO y' ,w I.i 1P a':._ff, .._.,..•w . .-..-I.:.,,,:tun..,l,+r.,l»_a-..f.._.,;j--t-u. - Ii'.� �. F,d. :i 11.rls F .-.{'f.we., - r , u,. ,. +• I (.-' . • . Clirti'OF TIGAIRD • I ! r r , 13125 SW Hail Blvd, 1 RO. Box 23397 , ir. ',,, ,''; t1 Ya I ,,9 n, ! "'Y, Tigard, Oregon 97223 •'''• $ y µ T. Aft,c V°V I f:/:- ' 0 t,, ,::,,: 'ci:19' ,, es " 400 � r' Igo berg h�lon4*ra � S3� � , 4... 4, et ad, ' R 97223 X42 1,":.,'I• • I I I 8ll i'ttgltlitti$1111sitlil'h�ltl1 �'4s r / 9000 .A. 'ire' '�-�r�� '; r/' din C r , '', r chvn�rs bya ,nit ''� 1 a ri I U � 1. . 5300 evE,xopme 1 t , { Y 1 6 t Ave� Y i a e q rd r OR 1 97224 • g , �I dilltlilttiltililll$riiittlt l'1� ? .. �QUghtori ', 0 P.,,,,• ,� 1.5290 SW Crr� air ' Kung' CitY n 172.r r • 23 I 1 I 1 j, r 1111 11/attlIt1,1tll1l1 �111•1ltti6 111111,41ir itli11111/1/011/1tt1tltlit �F/ 4 I I r , 1 `I I I I Mi C r • _ • } standard and that time there were ???? change the r 'ghborhood to require 444,,so I ???? the position n' to the street r �' I th�ai, standar�! to be arti , " xo �� .. not to be over • • land ???? ???? called for in ????? improvement Paragraph Beth Mason Mr. Levere, I've read the various letters that were floating around in 1982, one from you, actually a couple from you, minutes from the City council, you IiI knew, recommendation of the staff at that time. I did not see anyone use ',the, language even° in your letters that you had changed the standard for the street. What I saw was language that said that Council decided to go with an , interim standard. Something ???? of the ultimate development standard which • I I I , would be l required of that zone, What was your understanding of what the interim was? What, period of time? Mr; Lever e It is a commercial street, ???? interim standard was going :???? the local' street standards at ;a narrower width, ` I ' Beth Mason " ' But interim generally refers to a period of time st Mr, Lovers Sure Both Mason and I want, it's been six years riow, Mr, Levers ???? would be brought up ???? full standard ??? fully developed 7??? be brought; up 7??? ???? was interim until ?"???, Beth Mason Generally, generally what happens is the City does not wait for all of the development to occur along the street before they require the street standard , to be brought up, They do it piece meal acid they do it as development it • It is my understands- that you are the proposed along the street, � � first development now to be proposed car ih this case Mh expansion to be proposed '' along that street s .nice the Liu in 1982, is that correct, is that a correct? • i I r r I I I r I I q . MAP , 1 tctc ! 10 'B4' L k tA,,,le\ CYLI:i C , t. ,,,,, 0.0 ' f'N4 e st.!+„ i yekt„,1 i a 1,....t ,,, ok,..., G 4-.4 iri• ti,e„.,, - ,., t.--0 k,,,,t'i 40, c.A. e.::::)Pl.* 61 1 i 1 to rat.. f',.A\ eIjv. 16 'V' Hy ,,Cco , U4,,. T Y 2. w;h �" y h.)%"7e trT� s wG"f" «p f )` 1,74y h t 0-44.7i, { V�, Nq {1 Y- ��yyyww a I'�yp f 7,. *y5 6 k"..,*`, l r 1 �,h,� F WM1 �al i.n b. r 'C'YtG' , . L...L.,Ke.,,A, ) t v 44,1 (q, tT ) C,, Tt.0 eellivi-8, i i '''''' 1' Ui " aw;�Y'v1 "CC? "� ' �N V v.. �'- + yam..' fiw+r� , A i 0 1 1 i,.... n:,,,40 8 ev,„, C-41, VA , . ,u.0 fq 4 ket L r.A,e , Vv., . t---c)v" ,'-.0. eft,„4,,,,,k,„. ., or ( ‘ , eh z.‘i 1 , 1 ,00e,;.. 1 , 6.. ,, 4,,,, , 0/ 1 ,--) Li r.,t.L.1 ,1' ,,,i telivio,e t','-, Wk E 0 L,,,,Au t$ V et,rvieA, 'D‘ ,,, „ ,', ( j `e v Viol, L.1,1A e ei . .. ' " ' 'f ':i:C1 40,S;46t:1'V 6 LIA l'Co?' ev3‘A ') t(t/li a 44''''k,'-4:",),,A cli,H.4 ' 10", , ., t F; 2 'ab 0 5ti C o UWa;r F * 0 p 6 4— . , . k, , \ , „ , i ek rY . ...1 . 0 _ ■ o . ..,, S • . , I. ... �� ..,... . ,. u. . . l',:,'.',,. , . a E' • : o ,� ' '' i \;\ 4 , ' C '6 ' ; '' 1 40%, ,,) ,1.,,,:,,.'.. " ' AM v i" • t t: • it32,„ • : : . . ,. : . ' a, el , , ,,,,i..--,c1 ' ' ' ' '' ' ' ,,IL,,, it"4 v` ' ! c7).9,.,:' :,:,A1 e)t.,!:)-1„,,, ! ! ! ' ':14,0,0 (,)',,,,,P, V6V,k(k4,41,,V,'',,p 1,!, L.,.,,,'0,1,'''r !",, . ! • , ' ( '\, k 5 W 5 t'il"'Nv4-2. : • . . , : . . , . . , : :: . . . • ., : : , • , , • :d l 0 :;, f, 'Le) h , : : 1. ' . L O Lmo' H 9cA\4, '.„4/t ': ' ' ' :. ,, . . 1,, .' 6 : : ' , ' 1:. 10 3: 00 '''''',,i,'', /t.) ti, to .4-',# ,H ', , : ,,, ' , . ,„ , . .,',...' -:, :' t ..:': : :.' :: : tteA,A?':41: : : H H. :•ifl.'i . .,. , • , . : ,,, ,, : , t ., , • , ', : , , • : ,,r(lop,,: , ', , , ,,,.' ' ,,1 ! .,! ' :i , !,! :'' !' " ! „, , , , ' " ,. ',. '': '''\/Z,. 0'eLki\e\f„,,,„V , \iltA 01I'P'.,,L kat' :I' 41i0,..He : ,.', ,' :, , : , , , , - , , , 1-„ : : ,,,,), ,, ,,,,„,„ou) Pcx. ,c.,:t ,,-.1.c,„ : , , : , ,, . , , , , , , . k � t, 1; .. . i, •;. ' , i , , , , , , : ,,, .. , : . . l• ,, , , , . , , . . . ,„ ., , . . l v \Al\ i e , to V ii' ' C '- '' Ke t ''''• '' , ' • r I n ,.. . .1 I . ,. . ,C,\?'!.''' *s 44', Ore"' , r� , ' o f kook( .: t e,'i� : , 1 . , . 4 . . , . 1.• • . . . , . . ,', .' ., !, , '' , 1., , ' , ,!: ', Pov:L.,t,'",,' „4,, ',::'.:1:, ':',1f:).P.,, ' '11 2.k 1 : ' : , • •t { • .4 • r+'aa.:.:..+A.X:.....,�w.a»,..r.L 1. i:.r.».,�, .v,r., i-'.. ..y.x...,,.a,,,,h.x-:,.. .a.1,>u,u..w,a�x.1.-.„1. +».�...axltH .»4Y.+... ....,,aa.. _ .,...i,.w +.. ....r. File #: of, M ,,),,.? 1 , Y:r i Applicarlt ft(:.,:.C.,:T'CR*4). Ltiz,,„ k4. 1:' 1 L„oc,,atiort. 1'� 3 ,) . .0.1plet, ilwy., : '. Decision Date + -8: 4' . CONDITIONS OF APPROVAL TO DE FULFILLED • Prior to E L PVitir4ii 'Conta t 8x grip O ff Dat_ a fp‘i. • 1. -Itt,C,,e.A,r,,,,,f,,-.-,,,,,„ ,e tie),1,1,t , 1 4„, iki.,0„Iti 1 ;0,,,,,,,„,0 ti e.7„),?,,,,I,,,,,,,,..).,,,,,,.. w i_ /___ i ' Al• . . 1 0 � 11 iv 7i#;?.IP r ‘,./ s ' 4 /7k , :IY'''L 100';Atl''illit,' , 1 (.':A tti://t5P‘,10 ,() , //0/8 1 , ,r '' 5. 5 r.. 4"''`1X 7' ,. ,F,,. ei,r 'f” _ /. 1 ' °o,i,'i 1, k tilt r0 ,h „, --`- 74 N' '�`e4 YH/.{'�'i M/r X.�/ �.1� r«' , xf CC 1u � XX � �a aGt 17,A �N -w.' r f„ /�u'a' X 1,`'1 , 0:, �' .X �y r' V eex �t"N4st4q `� ` 1"' 6 k7�1" V '"' ,. -'W .. .�,C;,✓ ..x � �yy. +� pmt 5��t'''°yyy 't Ita{I � I i � � � � y�' d i�1 1 '�X11 t i 'i� rr , . .. D ri, „.1 0 .. , I ► i . ' ' ',, , ,, 9 r pi , RWL i '4 �.T, 4, `I irk 5's ,� r � emS j' ,,, � q 1 9 it, it 1 :', i ;�yt 19 ' I l a 3 5 2/ ':,,«, ,,� ,. 1", y,, .d ,' (r:,,,kof11;„,.',,, (1'(, ,'.4,a,...1y,,f 1,1',4,w ilittt(L;;;' � I � 1 � .,,�FM.d� " j�,�� q ,. yr: �,w-y{��{ .! - � (�� a n y{, uf jury}j' "a.A'�71"r, � '�'f?41��{� � -� 't'/TL,',t.�i tpI y� °a'w uJ� %:, y yyb hWiy Tai �,N i f t it ,k.,r i. I,' , i f, a I, { b 5 i i 9' Ito 4 .,'.:,,n., F-....,........:' �l wA....w..m a...r..,a, ......a n...r.....+,......r.-...o-.l ....._w..,_I....L.. •. 4+. ,r..sx.. .*.:.r,. ,r.a..:+. .iN+xti .».•..r...,—_rail...._...,34.s_......_..rJ.,,. a.,.w., nr..r.,..rWx.n...r_ _ ...._.,. .,.0 .... [/, . r TIGARD PLANNING COIMISSION REGULAR, MEETING AUGUST 2, 1988 1. Vice President Fyre called, the meeting to order at 7:30 PM, The meeting was held at the Tigard Civic Center TOWN HALL ROOM - 13125 SW Hall Blvd. , Tigard, Oregon. 2. ROLL CALL: Present: Vice President Fyre; Commissioners Peterson, Barber, Rosborpugh, Castile, and Newton (arrived 1; . 7:35 pm). I , Absent: Commissioners Moen, Owens, and Leverett. Staff: Senior Planner, Keith Liden; Secretary, Diane M. Jelderks. , 3. APPROVAL OF MINUTES (\ o Commissioner Roehorough moved and Commissioner Peterson seconded to approve July 5, 1988, minutes. as submitted. Motion carried by majority of , Com�uissioners p ,went. Commissioner Barber a.bstained. 4. PLANNING COMMISSION COMMUNICATION � a There was no communication. Y .. Commissioner Newton arrived. 5. PUBLIC HEARINGS ....� �T �.�;i: _ y g $ t SITE D EL+ % \(rx : r a b 8 4 .;74�'„a�,�x Yr.1r,�.:1 s.�., .,ter .r.�1a' .,r...�.�<.s»._,,�., .'.;'i.':..3.r,w. .,, :l,..v.. , p t � a r AFL ..K .! �L�u. ..-+loo x i ®_ ., ' Request for Site Development �Review approval� 'tb, • :a.,:._ t ..,� retail nurser b' cony rust new y building, remodel an existing residence for retail use, and construct various site improvements. Also requested is a t , variance to allow a gravel parking lot whereas the Code requires that parking lots be paved Zoning: C-G (PD) (Commercial General, Planned Development), Loc ation: 15300 SW Pacific Highway (WCTM 2S1 10DB, lot 500). This 'item was continued from the July 5th, public hearing. d the proposal staff recommendation for iapproval eof the Site Development Review and denial on the Liden ewe made �� rec P Variance to allow a gravel parking lot. Discussion followed regarding s Meet improvements along Pacific Highway, access, and paved versus unpaved '''` parking area: ro^ • APPLICANT'S PRESENTATION o Lee Cunningham, 13385 SW 115th Ave. , Job Superintendent for� the project; representing the applicant, explained he had attended the meeting with the State Highway Y Division and Building main concern teas for future access to the at s nd to th site. He stated that the had approved site �e Bu�.�.ding T��.v�,siori ha proved the building f _ plans and they ate waiting for Planning Commission approval ' aP roval to be able to p ick them ttp+ '; PLANNING COMMISSION M I TTE 5 , AUGUST 2, 1988 page i 0 • i o Jill Hector, daughter of the owner, discussed with the Commissioners when they would pave the parking lot, how parking space would be marked, and what circumstances enable them to meet the variance criteria. ' o Carl Hector, 15300 SW Pacific Highway, stated he had let everyone else speak for Commission the main concern was '' s sp ��, or him, however ha wanted the �C fission 'know ��t an economic i-ssue and that he realized the Code does not address this issue. Another issue is that the grades on the adjoining properties are different. If adjoining driveways are required as the state has indicated they would have to replace all their improvements. Xea.is is why he is " requesting that the improvements be delayed to a more appropriate time. . He added that they would be putting a sign up for the required handicap space. PUBLIC HEARING CLOSED o Discussion followed regarding the applicant's response to meeting the variance criteria, what type of binding agreements, could be required for future improvements, enforcement of those agreement, what or if a time , line should be required for the improvements, and whether the criteria `for a variance had been met. Commissioner . Newton moved for denial Planned Development PD 88-03,�' Site Development Review SDR 88-13,,; and Variance V 88-24. Motion failed for " „a lack of, a second. * ',fommissioner Peterson moved and Commiss5,oner Rosborough seconded to ' approve Planned Development PD 88-03, ante Development SDR 88-13, and Variance V 88-24, based on staff's £ .ndings and conclusions except that the Commission finds that the applicant did meet the criteria for a variance because of the unique situation of the site and the difference in grades on the adjoining properties. Also, for staff to add the following conditions 1. The applicant shall enter into an agreement with the Oregon State o Highway guaranteeing that the applicants or their successors in • � interest the property will be responsible for installing the above . described imp rovements prior to occupancy of future � commercial buildings on either of adjacent parcels tax;lots 4.00 or 600. 2. The applicants licari...is shall e nter into an agreement, with the .0 it o Tigard ard ' guaranteeing tha t applicants or their successors interest in the property will be responsible for P av ing the p ain� area concurrently wi th the construction of tight-of-Way improvements : related to dE►ve p on either n �f the adjacent parcels fronting Pacific Highway. Said Agreement ,., shall be approved by the City Attorney. S. sign the 4 .... prepare... the final order and �: F re is to s. . , ' Staff is to n . ,. � y �� rase d V� ce �President Commissioner Newton P final order. motion carried by majority' o£ Commissioners At e . . �' >�t� voting� L10� .. PLANNING CC�M1S51O�1� M11�t[)``1'tS AUGUST 2, 1988 - Pale 2 • a .,I ._ .:._,_: ..,...- .n -"n.-.__,J..a..i...a. -.,x. .....r-'..... 1.1..rn......—u L.r...A-1w..._,...d .......,.-....1.+..�.....1."........--r1...—.,w...,........ N..- ..w..w,.. r.....4.....1...,"a,,.n,._ 1 ..r.»...w..J..s w .._....F...,...n r.r.. ..-. . o Commissioner Fyre ha;. concerns that the approval would rezone two to five ` acres to allow motel/hotels. He felt City Council should take a .'long, hard look at the impact this change would have. He had no problem with the landscaping request. M. I o Commissioner Castile had no concerns regarding landscaping and assumed that the market would control the transient housing concerns. o Commissioner Owens was concerned that reducing the landscaping would start . a downward trend for more request to reduce landscaping requirements. * Commissioner Rosborough moved and Commissioner Castile seconded to forward ZOA 88-01 to City Council with a recommendation for approval ° modifying staff's recommendation to remove 18.68.050 (6) A. (3)I, and to change the language in section 18.130.050 (30) D. as requested by the applicant. Motion carried by majority of Commissioner present. Commissioner Fyre voting no. 1 . 0 The Commission stated they would put concerns and reservations together at the end of the meeting which would be forwarded to City Council. "7-1 ' ��.{i p�"•'�g rR�hGk�1�*',7";°"i rJ!.r-��T v'.r��.?l•p�M,�+i�-'�,.,�..r Mi�4tr,N w.Nw,.l�vr,,...�wr';�r�.h,v�'l r+'��r�!,w s.-4,.,,?.p+r�..�wW r�.onf!.'ri F t.,..t.vkr'''.y.', ' f L,1'�;-fl y.t{�,'k�r;z�1.= .-•'-" . .. ww...,i�.f x•-;y" ""±.," r w ! �r 4 1fi 'y' Y 4 r y i 'E 1tE t1091,N y �,"'Io X.1 aq..1 "u�.,. •.j..h *'M g l O X.0,3aw 0 a $ x� s . ) `0„„ '6eIn eque s t fo r Si t e D ewe l o pmen e, approval to construct a new retail nursery building, remodel an existing residence for retail use, and construct various site improvements Zoning: C-G (PD) Commercial General, Planned Development). LOCATION: 15300 SW Pacific Highway (WCTN 251 1ODD, plot 500). Senior Planner reviewed the proposal and made staff's recommendation for approval with eight (8) conditions. . APPLICANT'S PRESENTATION �.: o Jill Hector read and submitted a letter objecting to conditions in the staff report and 'correction notes to the staff report. o Robert Ebert, an employee of Hector's Nursery, explained that the conditions imposed would make it impossible for' the im rovements to be. P impossible P accomplished. He asked that the Commission grant approval, allowing the parking area to be graveled, make it easier� r for them to waive their requirements o half-street k, vele which would he to negotiate with the 5 improvements, o Senior Commission could not waive� o e.nior Planne;~ Laden explained, that the could the State's requirments, however, they could grant a variance for a gravel parking a rea. Discussion followed with regard to the State's and Cityss requirements. PUBLIC I LAkIHG CLOSED o Consensus of the Co,. ii� mmissio � was that there are to many unknown factors with. e � raga. r d to other jurisdictions . u em a d what could� a and could ld not be Calved. The Commission favored paved parking and appropriate landscaping. They suggested tabling the item and directing staff to work • with the applicant to see what could be worked out with other, pP the� � � . aria dictions. N�IN�1'�ES � �v � 5; 1988 - PAGE 3 PLANNING �Co��SSlo�i� fA1 .,.,, ..,ry„,..,n.. .' u., r,......«.. .v. ...,,r J. .r,.r .......... ai.r . ,.,,�,..,... ......... n...„.,., .i.,.. .• .t .... ....., . M,., i... .. i .,.. .r xs. .,r ..... .e. .. .,.,,. • r � :.«,.. +. -..,...........,.,. tea....... Law.,. _r,. ... .,i.+.....,.r.. ,u.....,..I,w r.,, .r.... .u,._....nl..tea,.....! ..,„.1.•rl..,_:..a, .a .......- ,• xx * Commissioner Castile moved and Commissioner Rosborough seconded to table PD 88-03 and SDR 88-13 to the August 2nd Planning Commission Hearing. c . Motion carried unanimously by Commissioners present. 5.3 ZONE CHANGE ZC 88-06, PLANNED DEVELOMEYT PD 88-02, SUBDIVISION S 88-05, , VARIANCE V 88-20, LOT LINE ADJUSTMENT M 88-11 WAVERLY CONSTRUCTION CO. (EDWARD & LILLIAN SATTLER) NPO # 5 A request for 1) a zone change from R-7 (Residential, 7 units/acre) to R-7 PD (R-7, Planned Development overlay zone); 2) planned development detailed plan, approval for a 109 lot (two phase) residential development; 3) subdivision preliminary plat approval; 4) a variance to allow a 50 foot street corner radius instead of the required 100 foot radius; and 5) a lot line adjustment to transfer land area from the subject parcel to. lots 56, 57, and 58 of Bond Park # 3 " subdivision. 'LOCATION: 15400 Hall Boulevard (WCTM 2S1 12CB, lot 1300). Senior Planner Liden reviewed the staff report and conditions and -stated that staff was recommending approval for the second proposal which 'had been submitted by the applicant at the request of the Engineering Division. APPLICANT'S PRESENTATION O Bill McMonagle, Harris McNonagle, 12555 SW Hall Blvd. , explained that they are requesting a PD overlay to allow them flexibility on the dimensions of d the lots and the lot depth to width �e u:�rements within the R-7, zor�,�,� He P q stated that they accepted all of staff's conditions, however, he would prefer, approval of the original plan (Plan A) that they had submitted. o Irvin Black, 14945 SW 100th was concerned how the roads would connect to `N the south, especially with regards to Dorbttrn Place. Mr.. NcMonagle ' reviewed the proposal with Mr. Black. o Bandy Wilder, 8100 SW Churchill Ct. , was concerned about traffic problems in the area. He felt that plan "B' had to many blind spots° He requested the Planning Commission approve plan "A" (applicant's original proposal) with a stop sign at the intersection. He is also one of the owners participating in the lot line adjustment, lot 57. o Paul Widerburg, 8090 SW Churchill Ct. , Lot # 58, stated., that they are Ane• adjustment in orde preser'1 large participating in the lot line order to e � the�� la' plan preserve more trees. fir t,cees. He favored span ��A., as �it would re��r�� y Portland, 9 , . o � Dorothy Gage, 8000 SW 54th �Ave, Por 7219 wds also concerned what " with Duo Street. She had property that sh �' , did �:. dl was in support of the neighbors who want would happen rburn treat she to became landlocked.o�ked. She wa �were participating in the lot line adjustment to preserve the trees. She also favored 5,000 square foot lots. o Discussion followed re g ardin g the side line adjustments, r . ' d� t he difference between a subdivision and a planned development, open space versus private open space, lot widths to . depth ratios, and R-12 .zoniCl versus R-7 zoning requirements. PUBLIC HEARING EAE.ING CLOSED PLANNING COMMISSION MINUTES - �DL� 5� 98 � PAGE � p I . i . , bi< ° . ' r. AMENDED STAFF REPOR7�', AGEivtD�' A TEM 1 °` . . AUGUST 2 1988 -- 7:30 i�.M. TIGARD PLANNING COMMISSION TIGARD CITY HALL, TOWN HALL ),,•• . 13125 SW HALL BLVD, _,,,• TIGARD, OREGON 97223 u . . FACTS • 1 . General�Infor ration , CASE: Planned Development PD 88-03, Site Development Review " ,4, SDR 88.1 Variance 88-24 REQUES-r Site Development Review and Planned Development approval to �,, . construct a new 1,700 square foot retail nursery building„ .,, convert an existing 1,345 square foot residence into a retail shop, and construct various site improvements. Also requested is a variance to the Community Development Code's 1 requirement that parking Lots be paved. The applicants icants ;; ,�--'', propose to retain the site' s existing grravel, parking area. r''I , . . COMPREHENSIVE PLAN DESIGNATION: General Commercial I ", „• • ZONING DESIGNATION: C-'G (PD) — General Commercial, Planned Development . Overlay , . . , • APPLICANT/OWNER r Hector's Nursery AGENT: Robert Ebert u,; Carl Hector The G;alleria, Room 532 t ' . 15500 SW Pacific Hwy. 921 8W Morrison r�. Tigard, OR 97228 Portland, OR 9720~;, . \, LOCATION:t 15300 SW Pacific Highway (WC""M .2S1. 1008, Tax Lot 500) • i2 2 Subsequent to annexation in December 19i7, the City Council a rt . Apri l 1978, rezoned this property from the County's RU-4 zone to the City's '' R-7 zone The Plan designation a.l. that time was Residential— , Commercial. The nursery business was also granted Conditional Use approval by the Planning, Cvri)i1i siori and Sitc 'Development Review 1', ' approval by the Director at approximately 1h same three as .the? zone )Y" L. change . During the revision of the Comprehensive Plan in the early 1980's, the j ,;� . , , • ' Plan designation for this and adjacent properties was amended to r. General y Commercial and the zoriin�_j ' changed to C-0 (PD) (Gc ticrai 1 Cory more is Planned Development) , 1 ecarase the parcel hat been Y do sir nr' ,od with Lho Planned Development overlay designation, this' tYPo . P of development application must be reviewed by the Planning Coimis8ioi. 11' 3 v:Y AMENDED STAFF' REPORT HECTORS '1 � 08-03/80R e r y44.,. ... ',. ..,.... ...i. .. .......1 ......, i..,r a.................e.. r. J .. ..,... ......, ., .,,.,........, .,.,,.. r.1 1, x.,n..... .. ... . . n i °I • 1 • •x, f' A 1. r y ' r n � _ , a A • • Kb , • • 8 , uicinit . , ormaf i.onrti .. •• a C (PD) . y , the norw, north, re undeveloped.ed. 1°4 parcel to the south Properties - south, and east are also zoned G Parcels to t3ae nori.hi and east a p ti . , is occupied by a single family residence — a nonconforming use under • designation, Properties to the west of the subject thc.. present, zoning des xyna x I J parcel across Pacific Hia•hway are within king City and are developed ',.. with multi-"fancily dwellings • . Pacific Highway at this point is a four lane divided highway with a landscaped median. No curb, gutter, or sidewalk, are present. No left • turn lane into the subject property is provided for southbound . traffic. A left turn lane is provided aided approximately 500 feet south of th property. M urns at. this location are • to subject However, left turns no longer legal due to Oregon State Highway Division«roadway revisions. 4 Site information and Prorasa1 Description The 1.86 acre site is presently occupied by an existing single family residence, a workshop, a,.greenhouse used as a retail showroom, and two smaller greenhouses. The parking area is presently gravel surfaced and unmarked, There are numerous trees on the site, including several trees in containers' which have been placed 'around the parking area. The applicant proposes substantial renovation of the site to include • construction of a new 1,700 square foot retail ' store abutting the existing house, , construction of � new entrance g ate and fence erection or a new sign, and the future conversion of the existing house for retail use;'' Use Of the greenhouse for retail use will be discontinued . N' .,. upon completion of the new retail areas., I'17e site improvements and buildings will follow a Tapanese garden motif Proposed parking area improvements would include provision of 20 ' . , parking spaces at a 60 degree angle, One designated handicapped •parking space would be provided. The existing landscaping, including trees in containers, would, be retained, A now 4 foot 9 inch tall fence . with a 14 root tall decorative entry gate would separate the retail area from the parking lot. 5, Asaosly and NP0 Comments The Engineering Division has the following cOrririientt! 1 , The subject site fronts on Pacif=ic Highway with two existing driveway entrances. Pacific Highway is under the jurisdiction of the Oregon SiaLe Highway Division, Access 10 Pacific Highway ay mush: be approved by the I"Ijc, hwa,, Division. 2, Ar pubic sanitary sewer exists approximately 500 feet south of the site along Pacific . Highway, The site preset tly has two bathroom facilities with 2 septic systems, The proposed new • construction would not add any bathrooms Washington County's Health Department must certify Oat the existing septic systems are adequate to servo the changed' use of the site: • • AMENDED sTeirr R PQRT — HECTORS PD 88-08/S0C2 88-18/V 88-24 — PAGE 2 • r ' .....rl..l,...rru s -1,1u a1,....e.r ..t a..,...—...w...r .,...a....r.._,., _-r r,.. a. a,...s,.+.ref,i....,r,a....... .,;Irnil.rix•r......+1 r �.•ass ', In accordance with City and Unified Sewerage Agency policy, public sanitary sewers need not be extended r because the site is greater than 300 feet from the closest available sanitary sewer . - and the increased usage of the site will not create a substantial demand for sanitary waste disposal The applicant will need to obtain written approval from the Washington County Health Department to continue to utilize the septic systems for the • changed use of the site to completely retail use. 3 The site slopes to the south at approximately in� te ly 1 to 2 percent. j1, The proposed project will expand the existing 'parking area. This , will increase runoff from the � m site, In order that runoff onto adjacent property will riot be h', increased, the applicant must provide for roof and parking lot ,' drainage to either the public stormwater drainage system or an . approved on-site drainage system, The Oregon Site Highway Diivision carnrnented that their standards normally l would require, that the applicant provide curb, sidewalk, and subsurface drainage facilities along, the site's frontage, The Highway Division would prefer that these improvements be installed concurrently • with the proposed development, "I'he, Highway Division has, , y however, indicated that if the parking lot paving standard is varied to allow paving to be deferred until such time as either of the adjacent properties along Pacific Highway develop, the Highway Division is ' willing to allow the construction of the necessary right-of-way improvements ,to also be deferred until that time. It i$ noted that . r this could allow for the permanent access improvements serving the t . nursery to be shared with adjecmt uses, thereby, reducing the number of • access points along Pacific Highway, A The Highway ivision also cu . y commented, that at present the existing two i access points can be maintained but that 'an access permit must be obtained from the Highway. Division's District 2A office, Washington County ire District No. 1 and the Tigard Water District commented that a fire hydrant must be provided within 500 feet of all ,buildin s � r g 1>7e Fire District also recommended thtat, emergency vehicle access must be provided within 150 foot of all portions of the buildintgs on the site r The Water District also commented that additional water meter connections must be made, with costs to be borne by the applicant, The scg District commented that the new meter will need to be either a 1-1/2 inch or 2 inch ureter depending upon demand. General 1"elephor,e and Northwest Natural Gas commented that the applicant should contact them regarding provisions for utility cbnn oct~iohs for the neW bu .ldin{g y • r=tMIMi��.D, f�`;Ari REPORT HECTORS PO 88 03/SD 88-18/1J 88-24 - PAGE 41 I \ I 1 • • . ( Npo No. 6, PGE, and the City of Tigard Building Division reviewed the proposal and offered no comments oe objections, No other comments were received f 8, ANALYSIS The proposal aal 1"c r new construction and site impr o uc.ments at cte.t s n Nursery conforms with Community Development Cede C—C (General Commercial) zone requirements for setbacks, building height, maximum site coverage . (85 percent), and minimum site landscaping (15 percent ., required; at least 50 percent provided) A nursery is ci: ssifi,ed as an . agricultural sales use-µ—a permitt d use in the C--C zone, The proposal complies with planned Development and Site Development Review standards for landscaping, sigrtage, drainage, vision clearance, and parking except with regard to paving of the parking lot. A variance has been - requested to that standard. Parking, landscaping, and fencing warrant further discussion below, including an analysis of the regUested variance. Parking lirt Section 18,106,0$0(c)(8) of the 'Code requires one parking space for every 400 foot of gross floor area for agricultural sales establishments. The site plait proposes 20 parking spaces for the 4,287 square feet of proposed retail space and workshop area, thereby satisfying this requirement, Code Section 18.106,020(n) requires that one appropriately located and sized designated handicapped parking space be provided for parking lots with between 5 and 50 parking I spaces, .rho' site plan provides for one designated handicapped parking ; ,4 r•. space adjacent to the min entry gate thereb y .satisf in this I. Section 18.106,050(i) requires that parking areas be surfaced with . . either asphalt or concrete. The applicants request that the Planning' Commission grant a variance''to this requirement to allow the existing graved parking lot to remain' until either, of the adjacent properties along Pacific Highway is redeveloped, Tied ' to this variance request is eif • the. State Highway Division's assert to allow deferring right-of—way improvements until, the adjacent properties develop. Code Section 48, 184,050 provides for granting variances to Cede requirements upon a determination that tho vari.arise will not be detrimental to adjacent properties and physical or natural systems, will not conflict with the purposes of the Code and Plan, that City standards will be maintained, to the greatest extent possible by rihiMizing the extent of the variance, and variance that the e need for the ar��e� f� oi circumstances peculiar to the part xcular parcel or type of development; • AMENDED S i"Air REPORT —. HEC;1 OkS. pD 88,~,:08/-FOR 88-18/V 88-24 :. PACE 4 . i I V4 it ' ,. a + ._, ., .. r _ . N.rH r..vn............ w r,..,v,». v», .....,„.,....... . ..1�.4.i. .. .r..W, .....tea..............f.. .... ..>...r..-•x..I M w..r ,rn-. __ __ .__1..v.. .a.di ... n{:.J...r.. i In the present situation, because 'the adjacent properties are presently undeveloped, no adverse ' impacts upon adjacent properties are foreseen. Also, no adverse impacts are seen upon physical systems, such as adjacent roadways, or upon natural systems, such as drainage systems, Leaving' the parking area gravelled may even reduce impacts upon drainage systems because a gravel lot would typically produce less surface runoff than a 'caved parking I' .� ar'c_a i The requested variance does appear to conflict with the Plan and Code's o.µ intent in requiring commercial and .industrial uses to meet development standards typical, of a city environment. The primary purposes of the y ,, parking area paving standa rd are c to reduce dust and mud effects upon adjacent properties and :streets and also to present a neat appearance of development along major ' city streets, Dust and mud impacts ' p g resulting from the requested variance would appear to bie minimal. Aesthetic impacts are difficult t o ascertain. However, the variance would break with the City's policy of requirin g paving for commercial parking lots and could lead to similar requests. A number l of similar*, variances could have adverse aesthetic impacts and definitely conflict with Code purposes The Planning Division finds no evidence of peculiar circumstances related to this request, that would distinguish, it from possible future variance requests Numerous outer potential development' or redevelopment sites) in. the City are adjacent to undeveloped .. properties, The City should not allow this sort of situation to seta . precedent for deferring necessary improvements, • Additionally, the staff motes that allowing deferred improvements 4 ' creates administrative dif=ficulties in assuring their completion, Because the planning Division is unable to conclude that the variance l ' criteria are satisfied and also because of the possible administrative ' difficOlt.ies that could' result from the requested variance, denial of the requested variance is recommended. I I 1 Larttise. p n a x: • The proposed landscaping along with the row plantings and nursery stock Oh the site greatly exceeds the minimum 15 percent of site area which is required to be land�i.caped the trees in containers located adjacent +• to the parking) area satisfy the parking lot and street tree s. requirements, I ' The planting of rhododendron bushes between the parking area and Pacific, Highway will bring this site trite conformance with the Code's i ri requirement for parking lot screening, It is noted,' however, that the rhododendrons must, relocated out re right—of—way tF��at tr • be rr:_lucai:c. r t cf tF and that the --y-r northern—most rhododendron should be moved out of the required vision • clearuice area for the northern access, A revised site plan must he submitted which makes those corrections. • A AMLNDIED' STArw IZLPO i” — HECTORS PD 88-08/u0i 00-18/V 08. 24 - PAGE i I I I i • .. .. ._«.a..^. • .... n>.._--.1.. -_... i.. . ... .L..I._ _..+.... .....-J1...«n-.11 _.4-I.n--,d.N...h.-.......•-..... ......-.....,.......s-lu _.-.i.tn..,....n.i .4iL.L..«IY:wi-. nt.n.wi. -,.-.. ... . ..av-„n .....a..t W-il✓.4J+,.t4'«.Yl-1k Fences Section 18.100.090 requires that fences be no taller than. • r• ,. � 'eight feet. except when the , approval authority , allows a greater height. The applicant proposes to separate the parking lot from the retail area of the nursery through construction of a combination rock and cedar fence with a fourteen foot tall entry gate. The wall and gate are designed to complement the :1'apanese garden motif of the buildings and garden. The Planning Division recommends approval of the overheight entrance gate, • f xi11DINCS AND CONCLUSIONS — PLANNED DEVELOPMENT/SITE DEVELOPMENT REVIEW , • The relevant criteria regarding the Planned Development and Site ' Development Review aspects of this application are Tigard Community Development Code Chapters 18.62, 16,60, 1 .100, 18; 102, 1 ,106, 18.108, and 18,164. ""h� Planning staff bras determined that the pro osal as submitted or I I ' p with minor modifications, is consistent with relevant portions of the Community Development Code ba sed upon the following findings: a. Chapter 18,62 (C-G zone) is satisfied because the proposal satisfies the use and dimensional requirements of the C-G zone. b. Chapter 18,80 (Planned Development) is satisfied because the proposal meets the requirements of the Planned Development Overlay zone, c. Chapter 18.100 (Landscaping satisfied an d Screening)eonsng) �is because the proposed fencing and landscaping will provide an attractive o commercial development ih compliance with all applicable Code k- tandards, d. Chapter 18,102 (Vision Clearance Areas) is satisfied because the r • proposed site plan with mince modifications will provide adequate vision clearance for vehicular access from the si te to Pacific„ Highway. e. Chapter 18.106 (Of f—Street Parking) is satisfied because the parking lot plan satisfies Code requirements for number of parking spaces and provisions for handicapped accessibility, The parking lot paving standard will either be met through Commission denial of the requested variance or satisfaction of the standard' will be deferred until future adjacent development occurs if the variance is granted. • 1 f, Chapter 18,1:08 (Access) is satisfied because the existing accesses to the site meet Code requirements, The Oregon Highway Divi8i0 h may, however, require future access modifications to provide joint access to adjacent parcels, Any access modification will also be reviewed by City staff,' AMENDED STAFF REPORT T — HECTORS S hD 88-0/Stitt 88-1.3/V 88-24 - PAGE E . I • • • • • g. Chapter 18.164 (Street and Utility Standards) is satisfied • because the required right—of—way improvements will either be ' installed as required by the Code or else an agreement will be • developed whereby the property owner will guarantee to install the necessary improvements at the time either adjacent parcels (WC'1'M 291 10 D, Lots 400 and 600) develop, C. RECOMMENDATION The 1 Planning staff ;recommends '1 approval of Site Deveirapment Review SDR • 88-13 and ' Planned Development " PD 88•-03 subject to certain conditions. The Planning staff recommends denial of the requested variance from the Community Development Code's requirement that parking lots be paved. • However, the staff can provide alternatives for conditions 3 and 4 depending upon the Commission's decision on the requested variance, THE EOLLOb; NG CONDITIONS SHALL' BE MET PRIOR TO ISSUANCE or BUILDING PERMITS. STAF t". CONTACT: GAILY ALFSON, ENGINEERING DIVISION (CONDITIONS 1, 2, 4) JERRY OFFER, PLANNING DIVISION (CONDITIONS 5 and 6) . 1 • • 1. 'An access permit shall be obtained from the Oregon State Highway Division) 2. The applicant shall. be responsible for utter subsurface ' storm drainage pipes, and a sidewalk being installed dlled alorg the site's frontage on Pacific' Highway. Construction of proposed public improvements shall not commence until tho Oregon State ,. Highway Division and the City of Tigard Engineering' Division have i approved ''public improvement plans), The Division will require 100 percent performance assurance or a let ter of commitment and 1 • payment of a perrlmit fee. Also, the` execution of a street opening permit or construction ,compliance agreement shall occur prior to or concurrently with the issuance of approved building permit 1 plans, • 3 Y The applicant •shall obtain written approval from the Washington County Health Department to utilize the existing septic system) A 41 Roof and parking lot raih drainage shall he cortueyed to the public stormwater drainage system or an approved on—site system • designed to prevent r,unc ff onto ad jacont property Y ' ,, The parking lot shall' be paved, Parrkirtg spaceo shall be marked, The site p l an ,;hall be revised to designate the pa rk i ng lot as a rave d' surface and to indicate the individual parkings spaces • 6. The site plan shall ` be revised to relocate the proposed rhododendrons out of the public right—of-way and out of the • required vision clearance'area for the northern entrance, • AMENDED S A C REPORT HECTORS D 88-03ISDz 88-13/V 88-24 PAl l~ 7 • • _ __ .......,• x.,..r.N>,,.,. +,.,«L:.:.. .«„.w:1.,..,% ...,C«a.,,.,...•ua.ar«l:a...»-..:.a«.w.a,...-.._«-...:.�..0 a _.- irw.,..w.,.:r............. .. ., ,..._., .,..r,.ter....•.'i.�:,w»..y,...._ 4 � r � PRIOR TO l"HE ISSUANCE OF AN OCCUPANCY PERMIT FOR ANY NEW 1 BUILDINGS ON THE SITE, THE FOLLOWING CONDITIONS SHALL BE MET TO THE SATISFACTION OF THE PLANNING DIVISION. (STAFF CONTACT: JERRY OFFER) 7, All landscaping materials and other site improvemen"s shall be installed as por the approved site plan. 8. A sign permit shall be obtained prior to the erection of a new sign Sign location and size will be in accordance with the provisions cif Section 18.114 of the Community Development Cade. THE APPROVAL SHALL BE VALID IF EXERCISED WITHIN ONE YEAR or THE FINAL " APPROVAL. DATE. • ,,,A: A,A r it, • PRE ED B Jer^r Offer APPROVED BY: Kehl Liden As. 34 Cant Planner Senior Planner (ke/5645D) • I � 8 PD o 8-,-O8 J,, 8_- �1MCaP�C`�rc,i7 STAFF �" i ��i" - I" .. � �, 13/V 88_,24 — PACE 8 •.•,.,. .,......,•„..•< ,.,,, ,•,.. •.. ,,...« •.»,.,..,.,.. w.,.. .,.,.....••..,, „ . «.,„,.n.•,..i,•,..,,u.M,.w ,«,,,........,• .,,, ......4-.„_, ,. ,., •....... ... .u„, y,•,w�u.,,,. _ 1 n • ° . . • rOP • 1 J fi ..,.n.•∎•• "*`ry,�""tie , . d 'AA • .q , Al e � !•s . . : I ft,..., ` IR �t " . Q+! Pity) e.� o ,... ..,,(2) I '�77 m J �� a ca 0 ,*..:.,r / 1 , P 1 111 j 1 ., i x �••,,�J a t / , 1 4. Ql. i i 1 a& lip , ., m - � i « _ r�. 1 _ �q•r 0 1 ��V }tL:'..T7 1 r vY: a JCL•.•bp:Øp>r•x I Y• :';'�.''':' %{I 1 •.'.Y 1 f`J A .7r:� O. 'r 1 •} m i 'li'. r I l 1 N. , fir;{. I 1 •':mil r' 1 mil' } a •.v 1 •t f �. 1 . 1 :T:' .l ro MNaay.. � f'•d: '''H.: '''1T'•• 1 NJj ,'t'vitt:t:+r:t%}7>i:'r::':1:1:::1 r r �� 1 ,1,�, 'r 1 _ I / t. a, 1 yy / •... t t H Jj! 1 f•:}N 1 �;:;:::$::;:::;:;:. _, '•� ,< Via. W •c\\; J�( ::iilr.,:''': E. 1 ▪{• I W ti?rWflyn4 q TI r ii: o. o 1 1 ill{: ;:•$y: }:N:% rr"'r•'' '!, - / i 1,. O • i J O tih�'. . ,c M I , 1 ,+ii% :r:t 0 r $. SJ�y(,� ti 1 lo y.--,L'V: rr 1 t%lf:l:t:: 1 A9 r■Y. M,,n r .P .�r ''I'7 ry i �,( 0.1 t%%}:n •., r . 1 I 1 1 ,-+ ♦.nti 1 �'} CIII • I�I,�. ' i j 1 m� :u:$ :: I s 1' .� r,, r I H ! , co 1 I ,...4,::::,:::;;;::,:.: 1 113v .;:.: ID ...::; 1 to ge`I„ • • I :::::::::::::::::::::::::::::::::444 l ` ?:::: : I I .VV'o►,,, {{[[� sbe!90 OS .n '",oV 1, I . ..—...,. . Yr. .r...�...—..—...�. ..�.r..—.=:�......:....�.,..—r.�—.� .�.•�..—r..w�,...�...•..—.,�..J Y N, , r 111111 • ....nr_+.•.-.,y an.:, -v•r,......,-. .i. .r... .....i.a.. a,...r....y,m.__..T_,.-._ , . r. .,.,. .,_„r . „ ., , .. ..v. ,• • • • . • • • t - - . • ' . . „ • . .;- . - . C .. . . . . .: ._ . ... . - . .. . ...- . .. .. . • - . IIIII1 ' . I • - . . . . . . _• _ . . - . .. - . •, . • . .. . - _ _. • . . . - - .., . _ • - .-...._ i• •- -,.- - - _ _ - ._ __ _ ._ ., a KKK( • • if--- . 17;_ _ aarcircwiralarreaa-irirwiravaratrawarairalralarrawarrameaveavirairaral - calcarirriranravarairirararairrarava-aaarratarratarrawirauxite•wrrara alrairatalcartrawarrararairarVairavrairrarartravrairavairataltirrawa areal, - wacazavvraierrarrgirziravrtrmictircirtExartxxrxicrtriralerwrtlet alneur, - 0 . Arartirairrairaara-trarairarirticrirrirairwaaraimaiririralralralrarainririrairairrarra xvirimealrarralrairirairtiriirear-arairagaaltraratririraawcalrairiratirarrairraar. , aairirartalr-irktairrairtirairatirratamiratatartaztatairairtarrirawaraircirak . awk ■roltittiametrioncricttirrIcriarrelartveriectlravarrtaIrvreagrerirktVratirerairra - - 1 r. 12 nratairuiralraiririractrazzairrairciralralnrtravirtralorickaaviraXpalatrairtarcarr..M _ wirerraazzairirarreeartrairtratralmettrairincairarrairaranoriralr ,ramairriraaarriratrzrairarravalrairravratrawaviriormairaarirtairraraWarrarrairarzarak- ,E5r---..c-thrtrrct-aVrravrrwtrrirtrikkra'a'g__rraataalr/rtrrcauxrramrrrcrarrevzaralrtrrrmltxarraataa„.„_ warg_rreirwarraretztrairriravair Arta rra'arratwaratarlicrirealr-ErrairalralraarclirlratarratairiMira.- 2' —8" , ...._.alooloporirtirwramtztvrimarirwirmimgrximimrtrvirwirwrwrIctxwirwirirewirwirtw.vbee. ...gAlmirrotoximorwa..-- _ ; ,_ , , _ ...4.rxxv..-(..gwarm xfirarraywarwalravar,-grarvarywrzwayawartrwavaaarwararrawkwatamairwacaamzerw . • .1.111111.111.11"• --,-- - . . . ' - - --, , •-_,..- --,--'--...:.-.-..-,,,_---,,,,,--7.,--.1g.t•-_,_.--!--,--:,,,,..- -, --14'"-Owlgriirararaiii7-..Rin:--,x..;.1 --_-==.:: i--.1.='A-7:--7 tl.7.--3-1k.-.--- -. _.--..-t---- -': ..--_-..-.-,'-, - --'...•,3:'..:-'"----...-Y-3,,-.1.1,--”z-_,i_..-..-,-,,,,.E.-.:.--_-_,-,--,,,,,,,,JE--. 1 ' --.• Ilaltallfill spa RR ssR wo, n:.ilial ism: c'-w.''-'m .;''''''"-n-''''A'' "'"'b'-''''"-vl-'a.''''-A4 4-''.,.'1'44...''...i.'t.'""...'"441- 4'. - I *--- 0 P . . taliamatmair NM:Z % ann. tilliriplii F§Y., zrg.- ‘wv,,,,,,,,, AmminVipgt7MMA 13ti MigdWai ..-7-i--- ....-- r ow onnown:I,,y, ‘,‘;',..-www • - - - - i .26- r. ! - 4 . -- - - - - - - - MB al11104 a ws. es% •-•-•'', "sYs,PAWs"'""'ss 00?Pis VitPA' ssioPPAs"..,•... SCY0/0,04cWP.1,,,,,,'`WPississ.; PAW0s*/.11"."1W4CW,CWAY 1 22- - -- - , i . _ . . i ill x 4"Cedar Trim- .- i . _ -- } - 'an Weir i . -"--2"x 6"Water Sealed - . / t ; 6"x 6"Watbr Sealed Clear Cedar Handrail ...- , . - - -- - . '..c. --12 ft 5 in--41 . . Clear Cedar Posts )1 .._ , , .. _ 1*.--12 ft:O.In )< - - _50 ft 0 in— --, ‘f . _ - t --,-- SIDE ELEVATION - . . • ' ._, , . , t . , . As. -- _ s . i , - 1-x-2"Cedar Trim rt. - -- - . ',.. - __ Metal no-Roof . @ 4*0.C.Vertical I _- - .- - • -- va-Orienbal Mod 12 I- . - r--- Over 1/2"Exterior . Installed.persillgrs , ,.. . ,- 4-51 . •lil t f.-1: RoughsaWn Plpirood f .. _. . Specifitations. f - eciramaraThret,raircmwzr-ar_ainvcrevcremcgrwrirrairaltiezralcirtrtritrivErwirrimeritintrartartryr,, .,i-,1;-, .1. :, ,;lit II,_!-. I . 1 . -, :.H I „ital;.-, T;ih,,-..,. ; - - . ----- _ _.rwiraraximirrwrincrwirrivert*wilrirWrrramantxxxvirwalmartircrimalmionrwrigiarwwwcw*Werva _ , - , ..scirWirrtrairwricricirgwirawwiram:or.Z.1rEULattalcricetiminrwircirrirekrimirtrrirrWrWrirztVarnArbrzirwstvirrirriorkwalrximir.OwincrWicre-riramalcrWalmralminyvtirwtorricarattiganc.. - ..., -a-azalrintic..Tgrilr.r-araviralra- _tap!avicratrarrairra,,,,,aaartfrarg_avr,/,..-.0-4wrraarirstrarrarrectraalcarririrrarataux.as-a/calraxxx-rravrattaircart-aararartara... y.-- - - --- . .....4141WWWWWWWWWerirsztup:‘,:ggligarsgt...EtrU..........SWss...,,,rwss...WWSser,4SWEVISSSWaStrWirrstleskrsirASSEMSTrtartricirS*SWAsSIESSSSICESast.gSV.WWUZUZIMU._ ii......ssuussusuassusuwsususrawossuswwwwwwwwwwwwkwassararsussuassuif i . . -,-.- _.., .. =WM MM.IWIM=11111111,,,,, .. -- . ..: 'TI. il-72.M,_..._-.„-._-,..--::- of am ,,... ,_.• - ow NE .,..... - 1----..-!!...,-, ..._ =, .A-,--s-4-----s--,,--r s=--=....,. .....--=.-._,r.-- .,-;•i::::....assis oasts eliVal 011111..IIIMIN,1•111411-AM OM ft -,,..-•.:'1 TF .' - -.2n. .-M-..., . ..- ' rit,....-,,..--2 ....v...-4. y -4,2,-44_ "-,-,......s.44......1.=-S.-- .,...:...--__ ■ :?1311M111111';:i";''.5-4 1':11 Mil:ill 1 - . ,'101:::::::::tit titiii . iliallit Ilid-mli 1111-111111i. ...''.-7-' I. . , . :-....;iiiiimp,-,mai:f-s,--, . . . - Moon Bede En_by - _ • , :::"----k,..:eeli::::::::: :k*-,:::::::::: :::::::::::. .,, ,,, wasse:= .7:- MEIN liglir - 11111111-111111111-f Inn Nall ,:::::::t:7_8,,Radii to courtiani „ . . V zirCecktr FaSCIEt E.,::::::.,....,4,-,...-:.-:-..:-,,,,,,::::„2-sa,..,.: scums . . t.,:i.42:::::::S5:::::::"B::::$::::::::::2:::-jiff:.:::::::::: .,...:.-..:.K.:.:....*........--1'.:.:_:.-.S..:.: maw Roughsawn-Texture, :::::„.....::::::::,,--::::::,:::::::::::;:kl -. „.-7.7.,,,,,,........5k.-::::., . . ,,,......11.1111111•0,11.111 11111 1114111 ' lilli Hill 1111111-1 ....---1.---, ' , i:E''3. - . - - - .Z - MEESiitiMES Isz;sgsaes$42=435sdEtkam-3.1M8252EESSME3--,::::::::-.-,,,,--. 4 ._. - , 1-x-1"Cedar 1- 12 x-4'Cedar Existng:House—/ . - Mullion:Grid Trim(Typical)._,... 41 3n-6.-k 1/7- Ne,,v Greenhouse Addition • Attached to - New Retail-Building Rough-Textured Acrylid See-Shtafor Details' . . • Window-Frame Gement Stucco--(Applied: . _ -r . - --i _ per MfgrsSpees.) - yp.@ Windows) !_ , - . .- . - . . ... FRONT ELEVATION - , • :- .- : . _ . _ .... P -_-- • - , . - •---` . . ' • .a -. ' . . ' .. - -; ' • , . , • - . . . . . . - • ./ . - , - • " . . - - .. .. . . - - ,‘ • - - . _ . . . . . . . . . . . AO' • -- a r a c c, A fre Gov,- ,,, . „-. . ......i 1..... . . . , 0 . cr ,c,. 1,-„,,,00=_ ..8 .„-s?„ _ `w dr_ A: �.: i�'�'. - o q ail - °- ea - tP © $,' �►� ,�f �t, - '• gam,_ v0 �,' _��•t X23 I el acs ""mss 4.6 01 O rn • rte �j p` � $1 O �. .T ice_. e f. ', r lift- i -i'co i . r / § a ° ? '. �� =Ha�y�:�Q� � ` 1111? 4z:s� s_ lid. � r (Qit 4- - - .-1-- .-S i 0. Qq$ 1 (1 0: 47), :� r . t <..� 9°047 22- I PAS °t� , - -i— g ch _ (f4:ea� 1- ,o IS 0 1! S t9e if cy 3V: O, ? O �� co r I �- i' v kLt I S` /I- _- - _- I -J - - - - -- - Ste' ` � 1 _ _ - _ l/- - - - -- -- co -! ' - d IR V :_. (so-06.30"E) e Me�Nt - oz's N Re 1 gns e�t��oo�ws:c H I: Rm 533.The Gallia 921 SW Marrigon; - Portland,� 97205 � U3)228-4926. ( 3)228- 994 - °°" lP°0 iio.. 'a L.... i . . . - . . . . . _ A • , . . . . . , • . ' '.., ''' ' , . . . . . . • ' • • • ' I , . . .. • ' ' , . . .. . • • N . .. : , . . , , . . ' , . , .. • : . . „ : , • , , , : • • , , , ' • , ' , • .• • , .. . . : , • , . , . . . • . . , , . ... . .••." 1 ....•--.. ‘.- (.•-'.•: ,.7 •, , . . . . , . , • ,.. .,.• 1 1, . J r7)\ j . ,d.64C(,j 7a o,k,„i„,,. eu tp k.y.,r6..i..,. ,.,(,, T:d.i..p-A/c•(R), D-0,e0)r6i E 9'. • . (/t ... • • . . / t`-----A0 / . ,....., • v,, . , 1 C.2) 1 . ...J3'Z .. 1/45—.::: ..r- ' , . : ! ,.. i 5 1 ..,.te, , .. . /1 /1 I z„.....il , a.....• / / .. , i .. ,•■ -,"-), I ') / • • 1,.. ******., ik 0000000000,oo-a,000 ' i I . . • . 7 r' . • --,--. 1 4.1 Q.0••••' i 1 I • • F".• 0 I \••••i ' . ' I' ‘ % . .". r IT\),1 . 1 , t 1 , . 1 I. 1 '1-----11/ .„ . . ..t, \\ 1 1 0, . , •.,,,..,.,„-,,,, \`.,,,.. \ . , ...,.... . , . 1 .5' • . . , 1: 1 I, , 0 t / i 1 \ rt 1 CT'," i . ' 9--------:--L,. . „ 1 I • :::::,::••■:%,:■:,:'•:■:::::::::*::,:,..*:::::::,:::::::::::::::::,:;,* ' ''':\‘:\.• '.1314 ;2;:aq \ ..........•.....•.....,...,,,,,,y,,,, . •i" ,,,....,....,..",....,.,.,„„,„,.„,, • 'Li,.,.'.:•,r,7....1,...1%, .. ' ...114. i"'t ' •••••........•••'''.....:';':•:•,:•:•,"444.,::::,•:•::::•:::::...., 1 ::::::::::••••:■::::::'''.,::::,:,..:44,:,...•■••■•,:.':•:.•••■•••••:. ale.: . :::;••::,..:''..•`..4:'PT.'...:$r,:'...,..,.4:,..:.•...r.:..:i:i.1:i•...r..;:••••'r'''....,....r''': '',,'/ , ' • .f.,:er‘....,/ta\i,Nifl, fir ••••••••■•••••••,.....„,,,,yer 0.•0 re.,•....."•••••:•:.re. 1 1 ''0000• I ' s'''''':.•••••... 'or'', NI ' . 1 :4444.:•:414.:4•24....:4,....4444.,•?err,•::•,••••••••, ......., •4..,....Vt 244 ••4,44•.• i n , •• ..iiiii:•■•::::"*:,i7:1,, ,•,1".,.•—,irip,i •-., i . . • ..•,•.••..••,...,,,,.,,..,•,.,.,....••...„,..:•,,,,..., $01...VN'i';'..•:'{," ...11';:".:;!.:'4:.iti Z:•,.'''..: •••••"■,"••••••••••■•••••••••••••••,•• ,••.••..+.0:••.•••••.••...........1.,,........,•;,.• i r '■;:,,,L.:::::::...,•,:4::::::::::::::1:::::::1:::::::::::::$•:OV:::::: 1 I ;*Si'I''''''4:.1t.,,,, g 1li''11:,i,/,'..r._ '... , ' ^. .•- ' • I .---.•••■•::::,,Vi:::::,.:;•:•:::::•:::::$::::;::;:::::::::4::•:.;..14::::.:::::::: ....,•:,,,:: :::,112.:',:e.:`,4,:',4$:;•?::?.4,0.0.:*,-.;. :..•••:•::1;;;;;;iii 41., 1'lip • . , • • •••:.:•••••••'.....::•••••:••••••••••••••••••••••••••••:•:••••••:•••,:::•:•••: ..o o o 4.•,....40 0 0 0 0 4..o o.•,••••0.•o•.4.,••,.2., ,••,.p..•44.,e4444.•4,4441...4••....,,,,,5....,•• ,o,o,r,•,.,4 • 1 •••■••••••..0.............,.......••■...0..W.......,,,,,,, i 1 I r,'••%*■;::.';'..4•X)0.:$?3I.•:,.'. ..% •":::::::::•:',••• ••.•,•••••••••,,,•••••■•••••■•••••,00.,,,,,,,,,,,,,• ••■•••••••"••"••"""" "' •••• .•••••••■••••••••••,...0...........',...,...r. ), ••,•4.3:7","•.."'",'...44•4,..',4'.•••••'''..,,X.Y.. :44:,..:4:Pi:::•:•.,:.::.::::.:.,..,, 4.:4.:444;:r, 11 ' . '611:$"':':::%%':::•:•:•:•:':•:4.:444.:•:•:•::•,*,:':•:,•,..:•:•:•.: ' 1 I ; ...,,,,,,,,"••''''''l''.,,,..,1•/■••.',•,,,i,..,„.•.„1.p. :•,..,:',......:rk:•••.:•:,,y,,,,,,,,,,,,,,,,,,,,,, r '.......,...,.........',1.4. 4.1.",,,),:,... .....4.....4,44...44444.444.,"•444......."..,,,,...,, . „ . ',.,:4,.....,,,,....,..,...„.....••••:,,,,,.....,..4)..p. ....4....,...4y............................,...,,.....y.,....,,,.. . . ,:::;,:,:::,x.::::::::::::::::::::::::•:,:44444444444..44.: tr,...44::10•:.4.....,,4,44...4........,..vm, ',...,...,•••.,........Y:••'•;••.....0•..•••'.....• •;•;44,.., F , . . ••••,......,•,..........,.........,...,,,, . . 1 ,...,...,:,.........,..., .............:••••,./..„.....,,,,,,,..,y, ,. r,..„„, .,.. ,,‘„ ,,,, ,,.,.. ,•,,,,„ ,,,y,.,., ,,, „,,.,„ „ ,,,„, , .........,.,..................................•••••••:„.:..., „ ,,...,.....,.,,,,....„4::„*.:::4,:.:*,....... ,::.,,,,,,,,:.:::::.,,,,,,,,,:,..:::::::, .......,...........,....,.,„.„.,..,......,.,•„„y„.„,,,„„ , . ...•••••.....,,,,4..,04,.........,,,,, ''''•ri'IKIIr!'?•••••4'41.••1...:.4,..,';',$'1,f1I.e. ..gf, e..::.:,:iiIi......:•?.....r.4.1::e..74:.ir, !q.'..:...fr.ir ..I. '.1.11;:.ii` 'a , 1 , r ::.,1.......,.4,,,,,.......,,,,,,.....,,..„,„.,,o.,.••,,,.....:, 4:::,,,,:::::::;;;;;;;,..,,:::::::,.:1•;,:.:.:. ::', '44,:•• ' .:,10,;,.,,.,,:•;',..$0.•it.,•:■!f.,,',5';,• VP,Vef:,,,. ,:::::•,:::::•:::::::::•?,1*::::::,:.:::”: i:::1•,:A 1, :::,:.$• • . iiiiIi?•■••:iiii:•:',..:1"..;::::iiiiiiri■iiiiiriiiIiiiiiiiiiiiill!iiii?:, i 11/ . I ' l',...,*V'',4,...:A:.:4',.1,•''•:',3 4:'•!•:P. 4%*%:;:■.*:::,:::••■•:44.4.44•:'••:, •:*•:•:;:: % ::::;::„ '- ' I (14 .••.*:.:*■••...f..**::::.ir:::%/Ni'tti.:4*.T''''' ..:iiii:0:.q..i.•;.:■,.:iiiii' i 4 1 g';'.....,',%.,1,*.'f',.,'4>•'4;...,;:',:i;'' :ic:*: ,■■••,:::;:',iii::,:::;;:,:;::,:;:::•:,:i$:,:i$,:i *;4:,,::::*:,,o,,,,.....,:•:::::::•::::::::•,,,,,,...,. .i. •■•••••••■•••■•■•0440,4;.,,...,.;4:5; ,,......,,,,,y, • , .•:•:**::;:';',*.f..:.;*,,•::,: ,.."•••111•:::::', .r.r.i*::•::::::::::• gi i I 1 4".:.':.':".f,:',...',•.''''''X'P'.."..).P.;'•'•P., •,','$;P:::: ::::::i$::::::::;*:::;::::•:•:::,::::,::.::: •::::,;:ii';' 11PRii•;:iY;Iie.::;:i*i..i:',.::?•;* .,,,,,-1,1,:-,•-•-',• .......- .41(r! . .......,..,...,•,44.,,,, 1 ' 1 S••P., • i ••••■•■•■•:•:•:•:••••■••••:•1•PF,,,,'N'.:•.=2::12:::::;:•;•,..2:::: '4::'40,.,iit,.•10••1,,,i•tyl,•0;•., • -.::.,...„.i.,":tfo,:v,.....;;:m..i......i.,i,,i..i.;•:;;;•::::::. .....;:•:::.q....• i.5........,:::::.::,*;;;::,:itr,:;:::: i •4..... 1 "'"'"*.%. ■ •%.',:., ,:•%....0:•:*•:•.•:••• • ' • •:•■•:,..:444....:4;•.•..:. ::::.;',•,••;00,1%.30,0,,•,,,:,;:: I '...."...••••••••,••••••,9%,,.....■■•0.A. • •r. '''''''''''''''''''''''''''''''''''''''O' ".......4 '''''''',..(::::'2,;:..21•••••0.0'.4.•••••.....,!•1.......2..'...10,,112;,%,:$,%2:2;f4121,2:2;•,:;',," . I W ,.::::,..,0,,:i:i:::.•„ ":;:::::':itir2V,:i:i*::',..'''' tl ,N4:•;:...:.r;;-:tky,N,',•:!:,,s4',:r0<,,,,Rhir: • . I 4';.:;;',4'.::;:••••:•:*•;:itiIt::::,ti:',:::,?:!kl.,,,,t,,,,,e.r.;::::.4 ''''''''':ir'40:1:.•;:;;;:;:.„.„;,,'" f,'•:,iii1::,::!.iiiiii:,;;;:iiii .. •;•:•••••••:•:•••••:••,•••••••••• ...,..,,,,,,,,, to,•:.:„,,••,••••••••,• ••••...............• ••••••••,,,• 0•••••••••••••••••••• 4•••...+•:..:.,'•A..r..,...::...4:}.',I':',,}1i1,•:::•;41.1$'4XN:'''', . .ID. "....:"..*:i'it::::■il iiiiiniiiiiii**. ' 4 ::::::::::•:::::•:•:„,„::„.::;•:....„ .........Y., ••••"••...Ye,.........,.. Or'',Yr..., "'''''''4,4•••••.'....1 Yr'•■•••■•;,•:../............ ••4•••••••'•••''•••'.'"•••:':.......I......... • , '•••'•• •'''••••••••■••..,...,........ I i i':'•q..,';'.'S''.'*'.':".1'.I.1:41.:,'41.1,%:M•4•4 :•:•:':•:•:•:4444:::. I •........•.•. I ... .< iriglai'll■i'r';'110,..■:'"i'ldi'ili.'I'■'''fic0, '0",4•;•:.:•'.1:,..:•:':••:. . I• ,,,, , .••••••,• ' •••".,'•• •'•'•• r...........•.....,' 1 :•••••........................,',..,....,•,.,r,..:11.;.,14.,•,..,.....,, j'''.•{......ten,. ,,: '''''''''''.1'':"*::;:'6X.":::44•M$.4A'r;'' ASP i.I1,...t.'......,".:.:'•:,•:•:, I ■•••',gr. . ' / .....................•,•,....,...,•,.,.r,•,,,,y,r,r,...., '''''''''''''''''''''''''''.4.••■•■•:'',14.•••••:•::::::::i::::',..:: 'A'r.:.•ral:;:::::::%•:•'''''•''',''''''t.• r r t 1 r r .•• •r a r r r r•e..........•••••.,••••:•..,r• •.............,,,,,,,,,,,,,,,y,,,,,,..,e,,,,,, I ....._ ..,,I$1,..,..:10,,,,,..;1,,,,,,,..4,..i.,:,,,,,?:;A:4,*.t:•• . . , -,, .,,,:::.::.,.i..,./.;:„:„,. : ....:...„.....„......„..........••.......,..............• —......, ..,......4,,.....,„..„,.,„0:„,. . --.....4•:,<?,,e, . •, t II) ......„„,....x....,....„,.:.............:.,•:•.•:.....:::.:4.......:,....... .....................•••••••......,..•••••••...ie., •••e•••••.......,....,•••••••,•,,,%,•„••••••••• P ......., ..., F,i I ......, ...... . :::::.,,.......*:.:*::.•,::::...,,,,...1:.....::,....,::...,..,,,,,....,...;,..,...,:.i.....1, , c.c io,.::.::....,,,,,,,:::::::,**1*,;*.:*:::,::::.:.:::::::........0*,: :"1--,.......„ / 1 • . ; a 1 ..... ...,.... .:::::,..::,..:,................,......."................... , : , . g• .„,...„...„ .....,..... „. ••,:•;••.•:•:•••••,........,,,,....,....,, 1 ••••••:4•:,.:•••••••••••••••••••••••:.,.....,,,,........,........, ..., ...,..,...,.,.,..,.,...,..,.„.„..,.,.,...„„,.,.,.. •••••••••••• •• ••••••••••••••••••••• •....o••re r......ro:.•oe,.,.....,,,,,,,...,.....,,,...., t ..1. :•:,..,..,....,,,,,,,,,,,,,,......,...........•• ............„........„.......„..„.......„„„.,.... . , :444•:••■••;,::::,...:::::*•■•:4•,..X4.4::',.......,i .......................,r.0,.......,,....r,.r, •0 01'n:44..........••••:'%;•::',:;,:::::',::44.., r'r.............:,.......■,,,,,•..,:. '•••••••••••••■•44,4:44,:•;.:44444..'...0...":. . , • 4.54. . •,:,:,:,:.:,4:1',:::::::',4:•.,...%.,:,,,,4%,..,,,•?„:•,..:(4,',' ••"......"....., .43I'''''.....4• .....,.....•,.....,...,.... 4...:44.44.:44•;',•:,0:.•:•.10,;•y•••40,4:40.4.:04:.:4 li WV• .14".)• 4.,1S,,a VP'',, • ..1 re. i4:•■••••:•••••••'X'......:4•Ve.r.:••••••■•••••:';' ......i .. .4......':',.'..........'...4..•....4,:r...... • ?Or•,.............'00,,,,,........,•,.... /34 , , ',i:,.,r:..1,1,.....•I:......:;.:',i;i,',::.:.1.,i 1',::i;..,,;'0,,if.:,i...,,4.i:.i.:,`!.."....,r,•..•i.....,,.:,,,..•'ii•,..,, I '.31- Al• 4 9.. . .:*::::,::444:".•:::...:4::: :•:•:.:44.: . * ' vt.tr' :-.*,,•!. ::••4••••:•:•:•:•:••,•:•::::*:•.,tir•ixf.;•:.;.x..44.;,;••,..,. r . ::::::::;*:::::::::::::•:::::1;•:•:•:::,:•::x•:::::•:::•.+:•:::$4 .. - J. I • , 1, ' I 0 ' :::::1:1)11•:,.. ..rclii,111111,,,7,:i ,... ,., , , i,.. i fisa' 1 ..................,.,...,.,,,,.,.„„„.,.,....„,, .:,.....,...,.......:.......t......,......., 4:■• • 1 I i 't• '.'11' iiii■■••■:i,N..i'....., 0 %..................%%.•":•:•1,1".../......•■•••t•%%,..../.4..• ill ■'i''' 4,,,,till''I' '';'*,..1::,:i:;.. M 4....,••••,;., ••••••••••••••••••••••••••••:.,,,,....„,.,..„,„....N.,,,•„„; .'........,..• •;•,••••••••••,4, •..,..„ • . ...A ;•:•;.:....:••.::::::::•:••••:•••:•••••:•:•:••••••••,;;,..:g•:•••..:••,...K. I • • , •:••••:•:•:•;•„,..,...•:•••••••••••••:•••;••••••:•:••••,...:••••;•?....:,, ,a...... •. ....,:r r,•,•,4 .....•r ..•..1.1,14.,..,,,,,,,,,.••..••. .4.14.• , .,r.'1,'■ ' J'',;I:i;',...:••••••••;.• ..ritii••■••:';';', .4.44.4•:•■•'... ''.••:•:•:•:.',•• r•.. 1‘, ........0•...,••••.•,.............,,..... I C . , ',..,....+:4 4.,...,..m.,...::,:::::,....,.., ,..,.•■•• M W ,....V,.....,...."•0',•:•000:0,40,,,,,...,,,,,,,, .'•....1.00,■•■••••,••••••or.•.•.. , ..*:;••••:1:■••,0:::,•4:1,:;:,,,,,44,!:.•'.'• ...•••••......,r,r,,, ''''''''•••:',..f..........r...,,,,,.•. ..44.:•:••••1................., / . ......,..' ''':',::•:,,,::::::::1.4,14.:::4i• ....„..,,....,... .,...„,„:...•••..,,,,,.•,,,,,,,,,,,,4.•. 1...........'•••••....4.o..0 0••••.444., . •4444.22:4••2••••••••••••••••••■•...2.• ;:•,:',■:::::::,.:::,k.',...•', '4:4, ...AY.' it '•4: ••••• , • ' • •...•,.,•,,...4.•40 4 ...... .,..., ..... ...„,,. ,Pi•,.24t. '2:442:2:2: *111''''",•.... . •••••••••••••••440.••••••,, rre 0...........r.•.... .....,.; ,•,:•••••,• '7‘.1 I I , , ••••'''''''''..............4..., • • ••••••• „ 4,1'::$$:•.14':::':444••. •:.......„;•.4.:.:. .:!...,....,....44...11.:„..:...ill i.:•:%:.•11,,i.:1::II.i 1 i'L.,..1.....i.,:•.:::::::1;: .!....1..„,.:1:11.....,....,0.....:i..:,.::;:::•::::..,•: ,.1.....,..,:0,,,..0,,ii.: ...,.,....:...,1.:::::1i Ca . , , •••••,.. • r%)' ma.azz,..zaz3=x,:.;i,aaz4.•'•"o','•.••r.•.•'•,'•'•'•'o',,,•'■• ••••••• , ......i a • 1 ••••••••• • • le••••1.0••••••••••••■1/...00.0.•••••11 :*••••••010..i•:W..0 i•••■■a•••■••••0•••••10•■•••••.0J ' .. 1 CI ....000',0000.4,4,00 . ::,••■•:...,:::4'.....:44.0:4•0.0.• I I •' ••••..0 .0.......:•0.0..0:14.1......."••• I ..1.......•••••••4.,••• .....,',..4••••••■••,......:•:' s. ' e, ,,,.„,,,,,,,,,,,,,, Fly4. .......1.'. ' I 1 CI ...............,r r.••.....,•••••,.„,.,•,, ...e... .„ I I ' ;,...:44....:,..,..11:1.....,...,, , ..........,...X...........,....A. 1 ......o.'..- . I . . • I P, ....,.......,............,..,, 1 r :::•:.:,.:::;;;.:44....:,;;;;;,.., 1. . ..,:•.,....:4..,:....:i:.:,;,.....:5 . , .. •,......',...'4.,.......r •........r,.,,,,,,,,, „.,' log ,,.:„...::::........,;,....:...:....:.....„ 1 ow•••••••••,„..... . . ;:::::::,::::::::,:•,...;;;;,..,,,.•v.,,,, , : '..fil•': :•••;a4:11:1*..e.r. •••• I 1 33 I „ 5 2 I ow,' , , ••••••..,..,1•:•:•:•: •:' I I "All''Alr■IfOlig ., -u kg,3 '-- ....01t4•00. .o, i . 1 7■1;:li.:„!,....,!ii",g• 1.■::'," •• • •,'.1,,••••••,1::•:::•:•' ',, . . 1 ,., ,1 , N.:•:::•••••:•:::•:.::••••••:•14•••••••••.: ::::::t.P..:::•:,••:•:•:•:•:••,:•:, t .•••••••••••••••••••••••••••••••••:••••• , ... . i'....::::::::,;;;::::::10,:;::::•••,:r... „e 4, . . ,....,. . 2 I ••••••.X.X.:,,,•'•••••■•:44.1• ' ' 1 : .4:••■:::•:•...1.1•:•:::■.21.2X1....V. •••'''.. , 1 ,...:!..:.;.1 1:...2::..,::.2,..'.,.2::..2 I..21.2,2 41..;•.....2,..1 I 1 I..2.:.1;...211 1 ' .1..,,Ho'.'''' CO , :1 . r.c. , ,,,.....:•••••••••••••••••••••••••••••• I •.,•••••••••••••••••••:••••••••••••••••••• 1 , • • ..;:•••;...;•,:::•;•:•:1•4;;;;;1,4::::;:: , I , , • . ..4...:•••,•:•:•:•:......,... ••••.•,.....,,.....•••••••.••••• , •'•:::•$:,:•:•:•:•••••"•••••••:••••••••• • 1••••••••••,..,;•:•••;•:••••:. ,i.:,..',".•:...'11...'i....4.:1:'..:i:1•11'0.1,!.1•Iii . • ' 1 • :*.i.,::::11•••••••••••:•:•:••••::•:',:', . ••••.••:•,•:••••••••••••••. 1 ;:;;;;;;;I:••;•••••••••••••••4..:,.;;•• I , •..••.4,......,.....,,,:, I ..,..,...•”......y,„ •:...,,,,,,....%:•,144.•;•.......X. I I ..i:0i■i■■::■■•:*:,ii,;ff•efo*: I .••••••••,,...•••,•■••••;••••;4. / fdif,,,,,;.,:440:•::::••::::•:•; I , II..../■•,...,,,„ . ••••••■••••••:”......yore., i : 4.W.44..44..../..........24. , . , , •.0..4.....,.....Yr,or... I '•...,,. „ , 1 1 . ■I I " . , • opt)Of)I. '001. ,i . . I 00 4:. 41 •.........••••••■•4•4••••••.::•••••••:r/r.......44.........i....14,.....,1,........i. r ' ' . . , I • :, ,. , , • , 1 • , . , ,, „ • , , , „ , , . I , . • a • . „ ., • , • ' , . , , , , . „ • , " • •• . I . . - , . ••• . . .1 .. , " , I • ■ . . , 4 '• . , ' I . I • / , APPLICATION AND PERMIT TO('-''' ��, ir�i � � �; � PERi+AITNidP�SBER , r _� L CONSTRUCT APPROACH ROAD �.'- p� ,, -/A,spoo'' HIGHWAY DIVISION ..: • HIGHWAY NAME MILEPOINT ENGINEERS STATION _ P ac i�f is Highway West _ 11. 3 9 flB7±3O HIGHWAY NUMBER COUNTY SIDE OF HIGHWAY APPROACH TO SERVE ' ❑ NORTH IN EAST 1W Washington 0 SOUTH 0 WEST Nursery • BETWEEN OR NEAR LANDMARKS HIGHWAY REFERENCE MAP AND ATTACHED DRAWING NUMBERS ' . SW 'Ne,eve Rd. AND SW Royalty Pkwy. 313 22-3 . ; APPLICANT NAME AND ADDRESS BOND REOUIRED , AMOUNT OF BOND ` ' ,REFERENCE ' ❑YES NO OAR 734-50-025(6) ' INSURANCE REQUiREREFERENOE 1. ADMINISTHAT1VE FEE (W c i.ved ) ',,. Hector Nursery 0 YES at NO' OAR 734.50-025(3) ❑ TEMPORARY DEPOSIT 15300 S.'W. Pacific Hwy AMOUNT C: K HECNUMBER �. -•—.� �` Tigard, Or 97224 $ 50 00 DISTRICT MAINTENANCE SUPERVISOR - DATE COMPLETE '�l APPLICATION RECEIVED • REGION ENGINEER DATA; �� X � - UTILITY PERMIT SUPERVISOR :APPROVAL DATE '• . ..d �/ % X ' , APPLICANT APPLI'ATION'-ATE ,� �/ "' APPROACH ROAD COMPLETION DATE , �— REFERENCE:OAR 734.51450(4) • The applicant.•Glares that he/she Is the owner or lessee of the real prop:rty adjo.frig the...ye described highway and has tht lawful authority to apply tar this permit.When this ap- plicabon Is approved by the DepartMent of Transportation,the applicant Is subject tb th.,terms and provisions contained he';ein and attached hereto;and the terms of Oregon Ad- ministrative Rule,Chapter 734,Division 50,Which is by this reference made a part of this permit.Copiss of the Rule may be obtained from the District Maintenance Supervisor's office, Issuing of permits under these regulations is not a finding of compliance with the statewide planning goals or the acknowledged comprehensive plan for the area Permits are!Squad sub ffact to the approval of city;county or other governmental agencies having either loin!supervision�over the section of highway or authority to regulate land use by,means of zoning endfor a , b�,tilding regulations,It sha[I be the applicants responsibility to obtain any such approval including,where applicable,local government determination of compliance with the statev\de ,i ning goals,(OAR 734-50-055) • SPECIAL PROVfS'(ONS y 1 if the proposed application requires:traffic cohtrof devices and/or special road construction,the applicant shall provide a copy of this epplicatioh ' - a to the affected local govern-�^::'ant.The origihal application must be s gn,ed by the local gbvernmont official �� . r LO L G t MENTOFFIC Sl,h,1: LIRE TITLE w – DAVE {' / �i /i/ 1. � 2 • applicant• his contractor shall Notify the District Maihtenance SU•etvisor's office at least 48 .urs'in advance of commencing work and ' cornplet l,the Work covered by this permit.(OAR 734-50-040)Telephone Number: ' 3 'ermit to construct road approach. The Highway Division will forgo fir • the requirement for curb-sidewalk and storm drainage along property `s_ frontage, until such time that either adjacent properties are '• . • .e developed or a change in of the Hector property is proposed . At such time the Hector Nursery frontage will be required to place thl ' 9 above mentioned improvements. , 4- Applicant to ensure that Highway Right of Way is established at 40 ' 1. . a I from northbound centerline, h • TYPE 4 APPROACH ROAD--=CUI �t3ED HIGHWAY NOTE:All material and workmanship shall be irtAccordarice With the cur- ' , ; ' rent State of Oregon Standard Specification for Highway Construction. I Drwy, ( R/W Line--\ i i w= 2.5,' Wt�= 3 2:t _ 4 4 [ 8 ,:: I / , \ ANGLE OF SKEW APPROACH TYPE CURB TYPEE f� _ 900 ' A 1 C � • / ' �\ See , �� Nita _ NOTES; -�WSr H ol�C7FtIifEVIA �- ' -- vv. �." ANCE A0141 FACE OF CURB TO BACK OF �. 1 I�RESENT ort FUTURE WALK di3,16 FEo', , l �� . WHICHEVER IS LESS , • r, . 'G LOOhC O U r b P W1 SEE TABLE A ON REVEL SE I ' :,.` PLAN , X= SEE TASLE A,ON PiEVEkSC,, , , 1 � i. M " . 734-33O7E(341 ), , SEE BACK o&.APPLICATION ' 1 ,. , , , ,• • 1 - ' • •t. , ...„ . . , . .., . , • . ,.•.. , . . , , . APPLICATION AND PERMIT TO , . .... 40,rx'N , fi ‘, \ ,,_„....":,ONSTRUCT APPROACH ROAD L ..' PERMIT NUMBER ' rt iff , . „III , . . . , ...,,,,,. HIGHWAY DIVISION , : HIGHWAY NAME MILEPOiNT ENGINEERS STATION ... Pacific_EIgh Wwja,yst 11. 106 185+56 __- HIGHWAY NUMB'iR C■"')UNTY SIDE OF HIGHVVAY ,,PPROACH TO SERVE 0 NORTH BEAST • 1W Washingtori 0 SOUTH o WES .' Nursery .. ____ ' BETWEEN OR NEAR LANDMARKS HIGHWAY REFERENCE MAP AN)ATTACHED DRAWING NUMBERS , '. _siaLlizear_e_Ra_.____ILAID SW Royalty1sEy., 3B-22-3 ---, APPLICANT NAME AND ADDRESS BOND REQUIRED AMOUNT OF BOND ,. REFERENCE .• • • 0 YES NO OAR 734-50-025(6) $ 111 P . 7 INSURANCE FIEQUIRED 0 ADMINISTRATIVE EE (waived ) ., REFEREHCE Hector Nursery 0 YES I NO oAn 734-5O-025(3) 0 TEMPORARY DEPOSIT .. 15300 S.W. Pacific Hwy AMOUNT CHECK NUMBER L ' ' Tigard, Or 97224 $ 50.00 . DISTRICT MAINTENANCE SUPERVISOR DATE COMPLETE. :•, X APPLICATION RECEIVED • • , REGION ENGINEER DATE • . I • — _I X • UTILITY PERMIT SUPERVISOR APPROVAL DATE X . , . TA, .41111I ,/ „ APPLICANT /Or dr, ,,,, APPLI ATIO ATE x lioat „, 0. .,A, ..,0-,-. APPROACH ROAD COMPLETiON DATE: - 4.11r;Iillit.-- dvor ,...e" a REFERENCE:OAR 734-50-050(4) — ' The applicant declare at he/she is the owner or lessee of the real property (*lin., a aboVe described highWay and has the lawful authority to apply for this permit.When this tap; . plication is approved by the Department of Transportation,the applicant is bled 1.the terms and provisions contained herein and attached hereto;and the terms of Oregon Ad- ministrative Rule,Chapter 734,DiviSlon 50,vu'lich Is by this reference made a part of this permit,Copies of the Rule may be obtained from the District Maintenance SUpervlsor'S office, issuing of permits under these regulations is not a finding of compliance With the statewide planning goals or the acknowledged comprehensive plan for the area.Permits are issued sub- bet .- ig the eagilurgo_vna approval t c:4 ifi)uenttfyleo applicants r other responsibility irtgye either joint including ry iov,eirAilteres4r1,712a12,il'crar goorv:114ithmoertittyctf cetreertghilinagol trtinodf ucsoembpYliamnlaan,segf zt rel 1 rsTa Cite ••• • planning goals.(OAR 734.50-055) . SPECIAL PROVISIONS I I—If the prOposed application reqUires traffic control devices and/or special road construction,the applicant shall provide a copy of this application + , to the affected local government,The original application must be signed by the local government official. 1 A 1 S , 1.00 OF SI ii. ENT OFFICI• ii i T ••E s ,. DATE . .' X ti ' ilf'''-1 —4 -----. ji LIT ---__ V' i 5 0* ary "0 4.,/ / ,.. ) ZW/Yey 1 —VI - 2—Th-a •lleant o' s contractor that notify the District Maintenance Sup-rvisor's office at least 48 hours in advance of commencing work and 1 . , aft,r c. pletin" ::work covered by this permit.(OAR 734-50-048)Telephone Number: 229-5002 „ 3- -rmit to construct road approach. The Highway Division will forgo ,.., the requirement for curb-sidewalk and storm drainage along property, . until such time that either adjacent properties are; developed or a . , change in use of the Hector property is proposed. At such time the • . Hector Nursery frontage will be required to place the above mentioned ,, . • improvements. - 4- Applicant to ensure that Highway Right of Way is established at 40 ' , from northbound centerline, TYPE 4 APPROACH ROAD—CURBED HIGHWAY NOTE:Ali material and workmanship shall be in accordance With the cur- rent State of Oregon Standard Specification for Highwoy Construction 1 1- I Orwy. 1 i-, — _ I i R/W LIne-\ I I W.., 2 5 1 W1= 3 2 1 x= 41 K----, 8 ' . —ANGLE ot,sKEW APPROACH TYPE CURB TYPE --------- ii // A ' \ \ 90° A•. 1, xii -- W -4-1\ \ , 4 _ • —478 \ fat g,i _)‹ , , ' c• i 1--.9 1\ , . NOTES: W.WIDTH or DRIVEWAY , I i k=01stANCEPROM rAcE or cUFtEl To SACK OF , q e— WI ,, :'• / PR E t SENTok ruTuRBWALK OR lotET, t WHICHEVER IS LESS °Lc wit Cu i-b A40 ,.._±.0 Wi =SEETABLE A oN REVEriSE A , PLAN x- sEETA•ml,A ONIIEVER8E -- SEE BACK OP APOLICAtioti ''' ' ' 1'' II ..,. .,,■ i \ , , Al •S . •, ,, • i. . . - . ' ,. . , . ' .. • .0 r.-4..., r 4....r....�•..,.• ✓...tr...A..+r k..•-r.w.�...�.'i.l..x r..•.n...W ..M......•.: wr-.-�t�..+.1 JWr.r;!-.r wa.n-4. F+--i+Y»....r.+-.1:..,.,.1.4r raw u. -.— it�...-.rm..n..r.� +.J,ar-,+�.a•w✓n ..+.0...mMnmtA.•m4..n.•W✓rii-:1�+.-1-..-.+1k G..:.44..�rL+�,lual�..r'W-�..s,�»:..Xiw 'L1'i✓..ALN:s.u.5�..+++.M+..:4'.Jw-.,.M..,WJGk n< � . 1ECTOR'S NURSERY 15300 SW Pacific Hwy. • T(3 RD,OREGON 97224 (503)639.9341 Agreement: 2/10/89 Between Carl Hector and the City of Tigard Hector' s Nursery located 15300 S.W. Pacific Hwy. Tigard Or. 91224 , . will at the time of the adjacent property developement or a change in use of the Hector property install curb-sidwalk and storm ' drainage, also pave the parking lot with proper landscaping. Carl Hector 1 �i1 � ,i I, � y� 'rrY'� • • a 4i q +Y pp • • • . ..r..,r .T,.....,,m,ul..,...l,l...... ........u„+r..T.,..a........,..,.,..,,.._.,.�..!..,,.........,.,..e_rv,r. _...,a.«.,r...... .,a__-«_«.a.._.. • WASHINGTON COUNTY DEPARTMENT OF PUBLIC HEALTH ENVIRONMENTAL' HEALTH AND SA}IIT17' `'gyp ; A li.cation Date- ”' Inspection S - AUTHORIZATION NOTICE Map and Tax Lot Number m Township Range -_-e.-- Sect:Lon , 1)t� Road and Add:eess L _ j AC /C ra r .rr�l y�vrrlw�.r..rrsr�r� Property Owner s d' c For �r 72) -. • This notice authorizes the use of this on-site sewage disposal system located on the property identified above to servo a p f=fj c�" with a sewage (type of structure) die flow up to 45-47 gallons per day Cis?DITIONS OF APPROVAL: 1 ,,fir • • dinr.w+.rrssaromo .. .. ... ... ._.., .. ..... ....... -... ... ..... .+rte • • ' w .,,,,�,«r1.�1.;r -12 r .+u.r.w:i.'vd1)11T3 .., � • �t l SANZT�IRLAD .. :. • iii P' GERHARD MATHEIS ' EE- 7-reite 7/23,/68 WCDPR 1 , ,44:,...aL1',-b..oc,) . . O'.; � ,iFr • regon toe Highway :; : . , 4i. DISTRICT T MAINTENANCE SUPERVISOR - � • NELQGOODRSCOHFlM IDT PO BOY, 565, BEarERTon, OREGON 97075-0565 PHONE 229-5002 !np14 'Ro>*erto • �. Jul 26, 1988 ii?reltzittli Ftle No,:� ,, 1 •�;, City of Tigard eirif OF Planning Department PLAN, GARS P.O. Box 23397 �E' �� Tigard, 'OR 97223 ATTN: Jerry Offer r, , RE: Hector Nursery: 5300 SW, Pacific Highway With concurrence from the City of Tigard Planning Commission, the Highway Division will modify their previous comments on conditions for the so:b jerlt development. Access permit to the subject partial is required from this office. . Asa condition of the access permit, the Highway Division will forgo the requirement for the curb-sidewalk and storm drainage, until such time that either adjacent grope .Lies are developed or a change in use of the Hector property is proposed. At such time the Hector Nursery frontage will be required to place the above mentioned improvements: The change in use of the subject property and/or redevelopment of either adjacent properties will also condition review of the existing I' access, This condition is in line wh item #4, May 26, 1978 letter, signed by both. Nancy Edwards, Design Planner of the City, and Carl Hector. , If 1 can be of anyyftirther assistance, please feel free to call, 8in:cerNly,y - Leonal I. Gunderson Assist. District Maintenance Supervisor LH(Z:rs cc.: Bob Sandmant a c, , Carl Rector �r m 4 i 8 1,a-5� F ) . . r c .. a a n o N r 1 n.u....l,..,...... .,‘,. ,.,, ,--„,„ „,, .'x..;.,F'.-. /4-1. ' C . ,..... . • 1 t4'''''' . . M , Hector's Nursery I 15300 S.W. Pacific Highway i I Tigard, Oregon 97224 July 8,19 S Mr. Robert Sandmahn Region 1 Maintenance an ce En in eer } 9002 S.E. McLaughlin Milwaukee, Oregon 97222 1 I Dear Mr. S a ndma�n .r I I solve.,0 We are contacting you about a problem to sol we need �. , .. regarding the issuance of a building permit. We had a meeting . .~ with the, City of Tigard Planning C,..ommi s si.on on July 5, 1988 a and explained our inability, at this 'time, to make the - . requested site developments. Tigard is willing to work with ,, us an _ approve . ,� . � d wanted to pp our plan, but told us �e must I M the state o first. Our. .� s+-raig`hten out state f Oregon requirements first: Ou. I a \` hear ing has been tabled until the next meeting on August 2. I � , Th1i cost of Construction of curbs, gutters, subsurface ' • drainage pipes, and a sidewalk far exceeds the cost of our . entire project. We are not rich developers. This is a small: �;:-, • business. �ne building permit is soug ht, in order to buil d an r , addition tb an e,isting structure. This addition would serve 1 • as retail selling T . ,. r(:nt retail ace occu Xe 1 �' re a g space. he cur � r 1 sp p s riart of a „ reen'nouse r and is comforta'ole. . ,, g s dot; humid, and un This retail space would revert to greenhous th he ctual f ,.. increase 1 in retail selling space . Th Tigard is smal] g and is The a Planning Commission )s willing to waive their requirement to pave the parking lot. Paving the lot w I �, p p ;ou1c7 cause drainage ■ » ate a complex . p drainage I e dirt drain J problems which would n gravel o�rer dirt parking lot allows for yste The current go have to deal with L The customers do ed by a paved ..,;�otlna simple clean ge. woUld be creafi ,� puddles and der spills which Wou lot. I I o I I I II ..y,;,4._....o,.,.,w..l+,.._..e. ...,..,,, .. r«......,i.,u•...« ...1._IId A.A„t...,.w-. .-f,ae,.Gl .,, ,w-.. t • •1 i «A:A.AN.-l4,A.. n, ,. , r a ..... ».... ,..c+. r...4r.1W."A.r he..,.wA+.4+Y.'✓GA..i j • • • • • t „ GI We believe once you Gnd your department see how we will be inp roving the view on Highway 99 W, you will be wiling to grant us a variance. At pi-esent there is no curbing or sidewalks for approximately ore mile north and 2000 feet south of our property. We would be willing at such time as the adjacent properties develOp to match their development. 4. It is important that this project is approved as soon as possible. Since we will be doing most of the work ourselves and because we also w irk in the nursery itself, the work must F.. be completed during our slots season and during optimum weather conditions. We ask that the Oregon State Highway Department approve this: project without any unnecessary conditions that would delay or prevent it. espectful'ly; • • Carl and Othel Hector Hect..or s Nursery • ccl Mr. Donald Forbes Mr. David Willhite Mr. Lee Oundersori i • Mr. gichard Kuehn If • r I 4 , • ., „ , , , , . . \, , „'i..l l y/ ;:7, 1' 8 , i 1 . . TO f r I r ARD PLANNING COMMISSION r �r a r � CITY' HALL TOWN w . .18425 8W HALL BLVD. I i7�H q OREGON / wr ' CARL H"la:�(°T"i: f • HWY. r I AF D, a ; : wa� ' l2 No; I'=';l.< r«i'r'h o ri 1)O v ►l+:►ii rn e rh'L PO 8 —030 ii 1 L K pr « h N vi w w3X l: 80-13,u; HVa .) y ,t«t for this opportunity tb rlddr"G Sc the ' d m r d s + f t H C Tigard P l a rr i n g Commission,r „ �HC ' fc i 1 �W7 " ' l rs tht conditions Undor which + building ,, .� ~r m tit may b E : s s l d t � I c ►r ' i' N o r s e r g ,Y xl N«iw.«{i{M{N.«.N««r.rrl , I, k We cr o p. „ ixa to' comply with a aN ; L o° r a) and l:h.)1 ' l•'t+«'+WEv(r p Wo fir :L soc t is ort c) is u 1w:i$(en A boY rn or any :I. f'i Ca s~i+»m"t p:ix rh G;'I to partially s+„"{1''E r"i I;H'1 E»? parking :L :'t V'Orrl . Pacific Highway would obstrutt the v i,e W of o x i;t i{r'h t t • motorists Ad dib I :ra[I y, ; h o maim 'of : rC a t 1r < ht 1„C a�.I"1 i r ► ri busy highway i.{i is t l rf1< I:4 that' ��1 l«t�"-�it r t?r t i 1.essential 'v H Vi, «eN r this H . � a small b t i ro for .. survival. AJ,s oy as a nursery, tho view is intrinsically ~r'► ru►.:tixvo and f'lowc r5 Ar ' usually blooming in this 's ' I • ►W�lr e :H1 h CNit!t d {l h t1';H'i/B fr i'i ;inIkt t; i Ej:►r rwh a ;;r: tt�w t eW�t i 1N r t y f N ?l'I I b fr in i s H'iirLh tt d ;r1Cn lest traffic bocauSo ho omb Will bo ti v rr " -'bh l residence., , . W L i m i 1 i a No with ha s condition i Hot only illogical,: • r but would ; v r H lr; � � ° ti rr l jb -rho � L w i construction of cN'bx b urf + d "r i,h» e ' 1.� , } and C� r:k "��,t w . H.: k l�;►w. l:� "s h � ► +z+ 'i1 �;H"1 r�' �%Y H:rr +je4 ix { MV'Y H« c b+�.r W± 1 L r,',10 rit+,,i t t»,+'P '�ii6o: +�,+;'�r,tE trL,l+w tx i cyr N. rl work himco1 f, Wo pro rh '+i; rich devtw1+�► r i iw,, t i� small bt«ts1 rho ss U The, hui�:L d:i,i itl pOrrni t i. %►r0 ht; i rh 'o ' r� ' ! ,, �w► build A rh ,, d d i.�'b i c+r i:+ ,,, N x i « ,t , N:A N� . it.! ;f ciorh9 p .40 bo: r:.'i nVor' od itit+"+ a r"i UAi 1 fl►:'+r s't '[h ,1 i 0 ■ •t , • ,«..,n......I..w..... ..r=,...,.r.,.....«..... I,Fr-e... „r_.....t.,...h.............d,.r,/-...,.....,..;I».....,w...,.�..,.,..-.........«,..,-,r.,..,...e...,.....,».......s,......._.t.w...a..:..-,».,._•........,..,.....1,......n.....f.........ti«._«,........-,... ..,i..w;;Jli+.:n.._...«_..,..,..,.,,w ....�_..«w.! ,w..«w.it...Fw«..«,.,.,...«.,...%.•..,1.+,.....:.f- ,.- - .....,.sti,w..,i....., • • ' , +7>' W., . w I addition wt.°su1,d serve as retail selling space the current retail space occupies part of a greenhouse and a :1s hot;, humid, and uncomft:irtab1i „ This retail spa ce ' would revert to greenhouse,3e, whi.ch Is not considered retail l se1iin space, thus the actual increase in r t i i e l l i n g space is small . In your report js was a stated taht the applicant wishes to pave the parking t ! 1 " incorrect" » " "G � information,Y T � 7 " w ; " V f l« l 1 ? lot would cause drainage problems which would necessitate"" ' a more complex cr a ii ag e system. Iu e to the n a t L e ��t•f the nursery business, a lot of water is used. The ' current gravel over di.i''t parking lot allows for air11plrH clean drainage. The customers do not have to deal with puddles and other ,pill which�h a Ll i be created , f:a� a paved l o•t. is think it is important to: keep ap i n Mind t;h t:,4 t± . our society is all to quick to embrace c1 high tech , . ' solution when a low tech sclution would be better, It would be waste o was . 'f 'time, energy and money (which we . ' don' t have) t � change ~ system which already, work%-a well and i.v environmentally sound. +i1•„ Wo WE see no reason i of1 tio obtain W r it te 1 a p r o v a l from is h1 e ' Washington County Health t)epar;[;mr rrt; to utilize the , existing septic system.rli. Your report t reont o1,+1x.:ii`y states the present i to has one bathroom served by 0110 sop.t.i, system. The f t::t is that there are two full br th served b- two separate septic systems. Ono full bath • would be eliminated and replaced by a half-bath (sink i 1 h r " d toilet)i l t ) r n d r e �r r „c t 7 d t o the e r b 7 n d»r e G ' Q septic system. Since the shower WOUI d be eliminated f rl N not N + M� 1 N1 1 i • the use Would diminish, r1ot Int_i'e sE b Al"mssoy since the residence WoLI,l.d be t:`.;tinvertiad into <i retail florist < r'1d not used for everyday cooking L"t h1 C:I laundering, W l rt a it i i usage wanti.riewre even more. ��hfi septic a 'tr 1r1� would decrease x tµt f t�t "+p s y s are n t'",t« tN.d woekXnr order, `ip ° �,w " i t t . ii the % '. ' I parking h „t, runoff ont% adjacent property Would lo t be , '� � � r � �� ' i problem, as it s r1t:b A pro�ioi cm hteaw. . Condition %i x is AiSO irrelevant berzaL,ze a fire hydY"ari'li already exists Which exceeds the regUi eemen't< of the e code w ic 1 ti states e s h yd r h t rri 1:,1 ;t b e ;h iwt i .t;e f:i h0 Moro • p. : . than 300 ft• et from try part of all on'-"Site bat: 1di.nr s The current hydrant iz o►t more th to 240 foot from all •. buiidi ie and only 14O " feet. from the ptropeei�by 1iiw 7, We have hO objections to t h I S condition, , i . . 8o We have MO objet:t iOhZ' to obt;ti,rti li i a sidn perfi t, but would like bh`ii fit` opp"or'tuni'ty to core tit ereoheous ±ri for :. �.... �..,..., A' Q A M. • n •• u ..•.....a,.,._._.-.....I...,.a....mM,...._,........,..',e.-,.w,«,......,w_..,.rte.«....».-a................. ..a.m�n.._.....,. ...+.,._.,.s,__..1.....a....,,..-. ,.a.,.M.:,:r.-,-,.,.. r,.,......r,...,.,W-.-.,-._:.4 tiL,,,.... .»-....a.l,•i.»x.,r..a,,....,.1 ' 4;. 4 � u• • .. 9 •' ,"rte mati '~ri in the staff report. Although pages 4 thru , correctly state the height of the entra nce gate as 14 I feet, page .2 describes a 7 fruit tall fence, the correct height of which i•s 4 feet 9 inches and td a 13 foot entry • ' gate which, as stated, will be 14 feeI. tall and in the form of a� Japa"aCierte Garden Bate. 1 think it i. i ! important to 7ote that the ent ire Pacific Northwest : s . putting forth a vast effort to increase trade with -, japan and promote N I <" business in this area. Hecti:::ir r s Nursery does bu3irt!~'toms with Japanese firms and t'� t Fri new i I a I"1 e r y a motif of the t >r iµ)t"l I"1d would't d be a iN t ti ICl"r" p1 i m e r1 t 't iwr o 4,l i :r1 t e r r1 c!t i is a 1 F r i e rl d t and d w iw;i u l d make . Japanese business persons (both J iw e vi si ti1g and those operating 1t.inCi toU i.net: cee in .the area) feel welcome ' and i'l a't;t e r e d w It would b e foolish r:i f the l,»`+.f t y of f Tigard t µ prevent a t c i a mu t ,a L y beneficial ,. improvement. I I•°.,w+,r'r q iw 1 14a 11 ICI w'r+t lW!g , Note 1 .1 (see ee page 2p paragraph 2) . there it no ~o„thbo„ra ai:.iwat t at th'1e stated +.,+t.)C) fei'�t w That atccefin5 wat eliminated without d i 5 s t s;i , r or notice t o the existing b t,rt t l i r'1 e t t::i e t„•►" . , Later U—turn access at the Durham *oad i m t r s 3:t iw o was al s . • ~ h7Yirate» a The current access is two miles south„ outside Tigard city limits. ,:I.,hi e r E is a d Ia q l.t a t e pavement at the . .' traffic t:;igr)a't:I. i t;,•)0 feet south for a 1i—`hiL.trr1M ]:t only rid a A, left ti.tr•rl arrow or permission friwirn the highway hway deI aritm nta We have a vt talked t::ed to the hie Highway Department r't;mer•1t and for over six ' ,� months the ► nl,y answer We Clay i.5 that they are stt.ttryi,ric the . ' ,:' pr►:ibletil+< • A i Note 2g (too h:)r: c;]e i a, & :h 1 the x e c. i,ci rl marked =Wat i n q ),a i Ae stated i. i your repiwirt, code regLtireVi=a one parI•::irig sp,i'+wt . i,'' for every 400 sq. ft. » f gross f l o„r area. Your report st a't;es . there will 7 e7, 612 W ft of pr "p »,eed retail and wwrk5l0p a r e 0 a r ie c wrrew1 ficurew it l ett thii 300C sqN fl. 1C2, 968 - . i p f t a ) which w o il d require, a 3 most „ e i 7 ; parking s p a w e s. . f W„ are, however, h rri f rhh M r cfrN e I f i Wlty t pa Et and n r + will be happy to comply with t ho requirement r'1t tNhat they are' te l:,)tor°k at least Y8 feet from property bot„tid ie+t amid' Will 5,00 a' , . that OUY handicapped t pa►':e it properly a1ist,; i t d with' tbye 1 . other spaces and conforms to code. It is important that t h'i i e project is approved < e 500n at ' , I p e 'i h i E +3 iic e t h e h „ N N Y % Will i � e doing m w t t of the Work I • ' t Mcrae ves ar beW t~ee they y a l to work i m t ie r` ~r tea'y I it 5e1 f • the io k mutt be Completed d„r I ~ g their al Ow set5:r and ' dUriit optin~m weather c µnditiaia. We ask that the P1arni10 i • I. COmMi55iOn approve this project p r o r f t Without a r y "mne:es ary : condition or that ° N � d t " prevent i t r , I a a {I. c p . ‘' ...0, .... .J...40-s....44,—.. n..V ,.....W,,.mw 44-m-:..4......:.>r..11......,4,....:Mn..-..,.,.,...,,,,1.1 ..."-w+;.,.....+.:�n.,,,......r..H.»-r.:--r.....,,,,,....-..F...'.-r:i;..:.w.;.,.....i.:.!.,..1,R..„, .. 0 d„ I 4 y y f .° ■ ' •, I e I°"i nai 1 y, we would like to say that we feel badly that . those;r"r'e pr ob l erns even have' to be addressed d a°1t this t i ift . Had , . the planner bothered to confer with the H ct or r y errwrerf is . inf; r ? t: or in the report would have been avoided and we also feel that the value of this project is self-evident. . . The Hectors are not only entrepreneurs, but citizens of . • Ti.Ward. Unlike large developers 1Iwpers who:. take their profits o ` e:h sewherewr they live i n Tigard,ard:l, spend their m::'riey in Tigard and employ workers from Tigard. The Hectors are of modest . means and do not feel they should have to moot these demands ,1 of the Planning Commission to, make unnecessary nary and: expensive ' property improvements. These demands far exceed the cost �:"„�f i the proposed project and if they are insisted upon, a worthy . project that would improve and beautify this property not , only to the h wend ±t of' the Hectors, but to the benefit of the .• r community of Ti gard as wel:i , will have to b abandoned. It a' 1 haiF, been said %f7t t the small businessperson is the backbone of the nation.Loon. Wi ask you to please not break this back and p destroy the American °en`41"E'` preneureai spirit. Tha r'ik you, • � 1 n Respectfully, I • . I Carl and Ethel Hector • Hoctor 's Nuttoory I r ' I K • e I I ro w I ' 1 4 , "•. ,• • • , ' .v � DISTRICT 2..A bn ,,1 ►fl ;''' ' ` 1 , 13125 .W. HALL BLVD, • � - JUN 2 1988 �P.O. BOX 23397 ,. , �1"IA�I�, 97223 �',. . ,:..,CITYOFTIGAI - j , �R r t � AIDE �: , , � " 'c. OREGON Imuk • , ....„) , • j u t a. 1888 �� ,�; TO: --4Z1- 2' , ' LA__4,• ' --t _r1,,,_• . -7------7,0XISMINGii))„:'4°' 'el.., ii4i dixd, egei,iLiti 1 [. , .. ,.. , ,(9 ., ?. 4. „Le.,/ ,- .•° • , a. zynni,a,r),..., 4 /14/ ': ,y. ,..q.,. , . : .. , ----.--. 1 i- -iii ______ , — f —1 it ' 'i ' . , • C ��i �-- gC' rats.'A. 6- , •.rr., .,,.r"r•i•1# r`r•*Ca arm y,y,t�.t„ry t','ri�{•.r C '!l ti r 5 jet''.#v•'pi. y 1S �•rl'P rb,, .r, :"',S#.�t=.- m;T:;s`r�`r'ii"re 1' -"'t,:4r. i''".h. '1° -•r.:c 3 j .i '''; i 9r;'`,�M `Pr•.r' -,', ,�ix•f?1't,,, H c•. ,,f;r�(1� 1.�t�•'S r { G- !Pii I ' «.`'�`�'-P „, '^�y.#,.a^3?.y.tA,.,,,! tX. .'�i.141 `..k. •. �r� i °r!'.r ,.. .•iJ��' >t,t :rain .rr.wYr;'�T`? ;n: Yr-- i,i i .,,� i„ 'i, ¢rs ,i ,3 '' .:r'r- ,„t. •fin •,l� •a,,„, ,, .• Y../r1 `y'�,r"1”- ", ji,? ' 1 q 4:F;e./i. :/1,'n'A .c y�/.r4 P.,,r t.•fi `^'.` 7 1:" . '•;�� AiMly,. 1 to ,l P R.4 n , � ,",•uir., ; A JT c't ,.,, "Y . "r ds �. irprs �!tr t•J.• �y. $�` S:!#s;i(�t.rl 4. Y3 nato ti,,t} � 1. �d�rr w,,� { ��g vi. v�" w Y i!# r, ,5 r7#�.� C. w �• �' , '•�>^ �:i ,:it ji''�., a,rr r g# NraRJl.g,, Iw',Y � : ..0 i „) r > ', '/'4�'v/ ,y r, � ',,,,,,.✓' a I' � t Q.� r � > ` � yt1+ F w�' t..f�o'4N.�j _h .1� �,�/ ,(, '�'!'� k-'��,,� � l�n t,,�fai�..r�' Nr°ktiJt'-rr: r�4�•'I•M'd;"� b+h L� ', iY'i7:afuW.r MY+Y11k1r,:,,.,r.4;f?,;:r.,41,1,14.Art e::;:,t791/s.� `i.,,'1 M..,(P.,f� t .,4:%" ,.-Lc"' :.,,f,AL",,t l � r,r r �7r`r' Prc�rF,r., !" �` 9.M" ,� rw y *t+ 1P +�3' Rt r S'iJ•'S'r*# k .r*'„� �M a,�i'�.4j.�t`Nri 71' k ,a,Ts' � Y#4 r�r :i•✓ ti i... ;~`'v M ±' ""J F+'N,r +P fi :3d�'r, �r't`?• r �i, /"' x 6 '*� 1 «-RU� i �� PZa',". �X r,f �" ,� 1 '4• Y '�'t'. �#y r t 1 rF# :fit« �T? �ry�;,*, �+ty3 G. '' it'�y�R V: '�C •. 1�r. ^y - ... •H" ,di: Ti,'i{)rL .fi7r p�^I. lyu�S}x� .V`, r 'f' y y�/,'�yt�,#;{inr"�{'; .•,�ar� Y' 7 apj g r 1 +:M MI t "y"' .3 I+SP ",?I ?r+< J Cr!' i"'" �•7 i rr 7.`,�,r 1. "v 4',S . ,r•Sfl 1 ,'' ':(P r' r`r'� f` ,f' W r .`,f tl, V'• t� rFi�`vk'r1 ` ��''r�'`. ' '� >r,,�'`'� �jY� I t�yr,ryy(�' (��- � i�,' e f,F..Ar,,�t��`.i,+� rS%�',,. J�•,+ J�` °r t7'�a p' � "'' r �- rf(r!{{�¢�{] '�,�d r',;41,f YM1,4. �rJ. rii � r aC.ttprG l•�� C ,!'� lWtY 1,1 „p' •#S • r/ V r '' '1' f r 1 i�•',i Y"'44 �� I tt,„ .{r'# ,—,7.744, ,,. w'1:14'„lY.rj'1 ,+.$ i..'•.:' .s ' i �.! TT II iiN4s t'lyta �, AW i+3r rti!•'ay4 r ,:r - !IIr'r •} , ri',1;"d.; ,K ;�(r� .# :l ��fuN. S' •! r,,,:y ., °n d a rr'.a' , .�4r'r r, +h t ,r�-• fIr f' ',4 'tf #r,, . a°,Its'• r,y. .4..A '• 'q•3, )A�+`w t# '+�X' ,,# .I.,,r :•14.4 v Vr 1.'�,',t,,..:4r!IA,''iy! ''''' '�'',re jl f .�•r 7raf,. r• i'�. .r:.'-�{ i 7 .”.4' 'd or,. 41'4" rrl,.r ,� -�� 1 ��Y�rl.r'1 1 r1� rr!r+, r• :�� V #Nn�4 f'r:,�4 1�,r .tt'rt � ,�' t n•r,li' +, � � 4-Ei `r' nf {r " �.N �.�.w,R L "I1 r +R� r. :" P ,� -1 .9r ,r'Y� ^ •.• r t 1 •11.0,, y I. •Y 1.r �, r7 ie. -, f Ft '`1 fv'w 1:,•..'" IS 11; y' �� wM•.r71 ra ,, �;f'n ,rA : i,.a,�'i, �" .� yF%rf' .tw.tJt•ri'• ,.er�*,Af' ., t l' tir i. .r,:.,t ht ".''� w�. �Y. tr^ .ri,, u t,`tf,R �!1_t", 4: 4 41•r .x9(41 1 �r., r r, Ids g,, '9/rk m # { ra!, •s, m . :r,' � ia" ,rr ''}e��1 t.'1 /ydfM�9l1P.k';•r'2r'.Y i�: ••.yi#� 7 1 ! r`r,!r.,'1, t .. rt.k,� 'A�,�'•e xf.•••rl i a,,,,,,de s"7�+� { �r ,!, x`)'��'A�it}'r G ' wx' tq' 'ra ,i r•. ;r^, ,•[r u.•. _w« .n r s..•' `%1�,r.•r _ +�f• .,: .r:, H r .j, ,• •°v., '#w"h;,-f-, S" rr,�M W,, lr• ,•al� 5,''':' � ,,,),,n,rf:� "YM,,r 'J rit'i I,. ♦n7t.3.:r;t to / '.l ( 1 ' J :SJ.• ,eti,, .Re ,- 1 y4,,,,i'n...G4•+�. nt,, wJJr ,,,to''qq .x'•a• .lnr .ro,','� :�1't ,)tr tt,. ,1Ga•.. ,�;:n'.,, }., A:, r^' 1't`,�, ,} rR,ar .t: r r'+°',+% .r r v r �prtr�-u �5 r. .s.'�l,r, •� �•� . -t. -1`x,t'ra,! 4 �n.'�"a w� A r � rt ! t z'. ��'"f �(; !J,n2•� t' �.� N tAi M'a1. ,1; i,',? 1 i� r; ,1", '1,,-,t l,,J =:a■' ift• �R�: • ' ,, a `.1. g r 7r%. .' n,• , �. �• nx ty`Qj. urL rt 4 r 'i:..5,,,,,',..�r1I, I .�+4•y,It. �'. W ,✓.,W�14 Y'i<-� r'+- j, r ',F. r� s�, ,. 1�+". �'�` r' t r r•x.• �� et .{, i�. fir 1r .f ;d, / ,a .a r» w'„Jrr:'it'1.,,i ,t/,.`' a t, r S ,1. •dxrr' t .rt,. ,A' `� 4 : - •J, /J' o. I.N 9 6 1- Tc.I"v" 4 ro 'A r►A�•t I"iYt^'r. ..�a .: Jl�'(((((�C(��Cllllll :.,` 1 "�-�i^ ..•r 9°. b/1 rr .rf n�tt�►' .h, Sr. -, li a 37••,,`� v r ,, ' ' 'w T.'�.� r,t #, .. A.� d. y x+- tI'a:.i„ ri;+r,,rc+.:v, r,,r.+ .rr%7y.•^Spi ..w#wr e.:,*.r x;''''?,r"::i'"„J: r +';,.• r,,,-. r# ..,,+t i4,- ,1y�„..�u 0: of- l=.a. r,,.Nti,W" n1 AMi•`rn,'".'Y`.r"'7,i',,i .l1`.,n,�' ,r 1.'r,sl,' •i- .-, 'r' .gi,1,,L is ..,w A" ;tor: ,-S .,.y pi, •e.`r ,,, a,l' R,i.,rr�:. �+ A *AY ;#•',pji4, �' FC, .t• "�d.'tf1,a,.�t1' r"l'r•,o- ,,rr,!,i'. °' ! ,�a'•. r r''r„,�. •t;" r3,+'tt,tr. �' ' 7"' r ¢ `,„ ..) t ;..+7 L 41 n�, #"L r,r- a.f•,n',.nl '1.r:.414!v�'1,It, e f �k .,' 'rl'''.1,,,,"V+c tr +.� �,{r,, 41, ,d J�, .:2,",i- '7.:�,��d.yI 'w,,.r1.- rh'' '�' ".r e1�lQ,rl,rrr •jf':!.'4r�ty,r, ;�d�"�ei .. 1' t,L 1 '�ry r kG«;ter?rt¢S 1 S t „t,. ,e' r`•`•�:.+�.y,,::'•r, � rti'i,:y.t e . r i}r ,n.....,w.�........r.. •:!,:' i-r.w's.,,..",.,i' .."'".':4:',1,,,.'.....r.'. .�,' r • # is r r �^,�r^r} �'f w t.4'�`c�K t f r,dn•,'+,�.`S l,-i w w A.Tr�r lr'"r"l�•r9Jr" ' :.• ', �. ! ° , rY�"J 1 ' .� fro( n � r?f,;i6 Y eY',,1 S «r ' rq r .d, .r• • ' ''''',„:4'..i,„'"•,trw7L 4a i 1 4 a �d'iPz'1in 5 u " 1 i?x Mi K 't,,...,.,-lt ' 1 ` ”r r, M1�`r r'[ r tr, ,W ,r ;, 1 .„.1 r .`i ka.i xw 7+. x •.w�L r T,t r'� aK 1 rur',wA W I ry ,',•,' "i. 1 •r ' ;. - R• '.•!I ULr•r ,t r rp fi i + :�j*.`',141"4. -A:r ,"ti:y'' ''''''';'4,24.1-4,.,1,' N^+I r'rr 4.1-1, ,, . A �.tr,,. !rT,M i4 ;ad.^'a�a.;�4'p t,,k}r S f 1 r:#c p r i- .1' C ...,?,';',14,•''',,q,'"'', t� . t ,y ' s ,„�4"'u.1 .e,5.d"F', F.-lw ' 1✓M* "1''; !1. i '„. '•':J j ,~ M �f�i•';i E" , ' A y r ri. •r"t r m.,•.,;� �k' ),� 'F t"•�1{„l1,r r rr •!,r,n' r s n«?, G +.e w i b, ^ +I r't d C r, 7 r i�p+'r;'i �r ,, r"A . A�S t_ 1 n i+ '4 Virr �'.h'k v l,r�'S`,y ,1 ` ,b.t,��r,, 5 4i1, Y. 1.jrr� Y 1 J IG " '! fGY;r; ."# rw y ."s. r. w' r F,d• i( ,, k r,,,r,,1 .'t d�!:'.".f i' #,y Ywr J ., ,6, I,'S�`r �tf,.#y�'n ,�i . ,Pt' �1f M s , ,,rr'"�A° '.l'^ } p , 9 k ,r„,. .l fa,Y;,}r',i,,qM 'u.y S,r. �.m{�'t'a1 , ti ' „U it.k,r.:'.y ,,.•i 1 , ;,h ti, 1 ,Ca• "6: r ,7 .'1.•i :i. r',:fl 1y!/ I4. r'bRN, Y rs 5y0 tI\4.;4(: ri. A.l r if:41 u' ..ip,i''',y„$,. r a � ,, ro ,, ' . � "•.s',,.n,i -«'" ' . . r ,^u'mi;o-rSa ' + •A 9 rr'#^"'j.7t' �~ rryw.�k::�1,r M0 H �I� "� l 44 y � �� ' ;Ijj '� `�tA he...�*� �M r �. �, !O ; ' �,r „ Al,. t w � Li4.ti .r.,li..r , l�1.':#t,t,; ;,.r e �- r.��q .Qr,1,:r' �t 1 a.„..7 S y#r ,'e 4'e. 1,�,� a «rJ fMX ap+ '1s{i Y•,;Ra_'S W: 4 W j i 0i T �A w , ,� 1 Pt,. et li h w.r r-."d U. ' ., .1# � �isXr S1, 1 A,,,; S4�i ,k,,,,�t� ktg r�_� ! i dr aM1;� !} �1��.''S#.1f. �A�i+tl"t 1�f�((!W(4 4,��, r tL,�. •r.; '�ti" +:k�i ii,..I f p.r,'"V!W t S4 C',r`,f'r r,j k�K.v f%,!:r. ....,.�'!5•�%.(:1..1 1,�rI2' iL.„6,tJ o v"d,aS1;�f,S f i l�l;„ R��hr,�Jti�ur,?r r.1 r iAf,f.,,ayi'sy!Y ynt{i i. T eq�•sy r:��4k�'i f+�»f��.f�'u p��.fiA itrr,� .rsr*1 r,7 ii; �t�:p.#��.a�•11 ,.Ue 1�?,I,,ttl� y.'! , a4L:�.Vr� ,.*,`1,ip/�i1�d, r,`,T R,'+?t+Es i�*, I'' LiR5PLY y ,.c . . , .. , . ” „tit ,,w tIL2d v„ . . z`',,; ,1' so,g,/,,,,z4 g,%1 r . 0 r- ' - ''.. '.' ';i' 'i". , dt.e..4.-_,—1§ ' ' . . . , .�° �' ... �� rY vc•� fit. : i`�-c - t .. i ' ,...._22,A2 -' . . , ,, .,ci ,.., 42•ZZ../ .., ..._fri'''• •• • if,.,- I s,, . ., .. . ,. , ' • I bATE• „6 0., ,,IL‘2...." / 4 ..' ',' KEEP PINK COPY FOR YOUR RECORD, a,rloe.rrr.rornw ., � � � Fi�, �A�� ETUA�I t�RiadI�J�AL�COPY WITH,REPLY, ��r< � � ' . ti 1, 1' • ' 4 ,- (4) Where natural. vegetation has been removed due to land form alteration �' z,1 or development, the areas not covered by structures or impervious f nrY surfaces will be replanted to prevent erRos,ion in accordance with 'r''" Section 18.100 LANDSCAPING AND SCREENING) , In the present situation, the Planning Director finds that the criteria are satisfied or can be satisfied through the building plan review process. The Director's conclUs.i.on is based upon information provided in !"• soil investigation studies submitted by the applicant (studies prepared by John McDonald Engineering dated September 6, 1987, and Carlson Testing Lab dated January 28, 1987). These stud .ee indicate that the original soil . • beneath recent fill material is firm to hard and indicates good slope stability; thots1opes are reasonably ; and that if careful construction • techniques are employed, the subsurface soil should be adequate to support the development ,proposed. The applicants propose that the houses to be developed1would be constructed on pilings or footings engineered to each particular site Conditions of approval to be applied through the building plan review process will assure that site disturbances will be minimized; measures will be taken to minimize the potential for erosion., sedimentation, ground instability, and other possible . adverse effects; • ;� soil characteristics will be addressed in engineering the foundation to the site; and non—impervious areas will be revegetated. Variance , Section 18.134,050 of the Community Development Code lists the following o win g ' approval criteria for a variance: � . 1. The proposed variance will not be materially detrimental to the . purposes p urposes of this Code, be in "conflict with the policies of the ,,'$ m Comprehensive Plan, to any other applicable policies and standards; and to other properties in the same district or vicinity; 2, , There are special circumstances that exist which are peculiar to the lot size� or pe,' topography rc.. to the sNta topogra h or rather ci ums � nces over which applicant has no control, and which rro not appli cable to other properties ih the same zoning district; 8 , The use proposed twill be the same as permitted under this Code and City standards will be maintained to the greatest extent that s reasonably possible, while permitting some economic use of the land; ;listing physical and natural systems, such as but not limited to traffic, drainage, dramatic land forms, or parks will not be ;'" ,;„. adversely affected any more than would occur if the development were ,•� looted as specified im the Code; and S, T hardship is not self—imposed and the variance requested is the The ' � � p r�d� h mihimum variance which would .alleviate the hardship • 1 iVoTxCE OF DECISION — SL 88--01,dV 88-08 — flAY MILLER BUILDERS — PAGE 3 ,, D + Q I A e lir ,,.d .. �.,_, •.•.v ..,. .-.. .H. ._.....,.,,..,.„w..n,.u...,».:d.,....,.._.�.,.....«..-..,...., ....,....,.w,...«.:�, ,...a.,,......w.,.,..,1.4,.«- a,..:.:�a.:a..«, ,-.•r......- ..,=«..ti,,•a.w«.aw:•-, ......lw.-...._,w'. �, �'-F.,,�.. .,f,r , . I ,. so o6'30" �/ • • 100.0 0t a • � � �'�,: � � 100.00' � �� ,^_,,,, L: . C F: Vii, ;7 it:::{I -a. r (. • "" E- a, v � 13, • x rr i�`' K, " v a. ' , ,,. 11 i h '...,04. �� .;;:;:':'9:; "ii.. en . (\,\ °1, �i �•�' ; ID `r' G ; ' '4'J. > . , � .:14,04::;;;•;.:•:; ""a, iii. i i'%� A C•1 L f �I i:. iiii f /r$ A'. ,w , is , Y� 1 a ::.;t3.;+fi B ii i%%%;a::::::::� i';i:k;i;: 1. iSi%iifii'i;�iiiiiii�iii O s 1 ocic , J kt 1 I I 'f i:;:;:;:�: ';:: i':::::::::i,:�.; ,■ 1 , • 'rr.'r IT, 1 ' .'...'.4, 1'''''''''''III4'...,111.1Iiiiiiiiii.riiiiiiiiriiiiiiI,IiiiiiiirMtP,I.,ti,,,:mill I!, • I { , 1 II 11)�fi it 'ry. r I 'a 1! Mry r 1 xk I ii i' , f;, 1 , s I t• !!�� i:i�:if:i:i,i:i:i.i:i,. , i I i L� immit 'is. 11, i 1' r ':i:iii:aii:ii'i:iii isiiiiiii iii'• �} � r .'. :<ir.,.:•i$f,,.i:;: rk,l ;:,}::5{::::' •adri J. / "fir ■. r4 ,1, I '�� 1 ; ;:...;,� ,� 1 j�o r. r a i W.x, f r 1 , ' 6:�- '� ...:..,..' : • x,r. - :. „',. ..4., .....,.. _..,�nw ......._,.;... ,.+.+..� �..i. .J, w..--,......,....,.....0 ... ti...,....rwH,,..'+a•V,i...;,1.4..,..«...,,s.,:.w4,..:.4.:..�.......a..�,.-«..,,I,.rhr,.««,v 1., 1�w...t...s—as ,v,r>r..+u 4,.�«.u k r .w....,,.....•.' R • • $0 06' 0" 100.00' ( 100.00' R,. . , , I' � 1 i'?•:f::::,,:'J,:::• Ir ' iii i. .....% .,..fi,..„ ■ I :r*ii,:i':i::it,' A A' iijyi iii;; b.:. t_,I,' , ' 1 36 Ac ,, ., 1 , „,„ ::::.„:„:::*:: ,,,,,l.:.:. . , " .. , ......14:::::::: . . , , . . , • , , . , , `yIrI E> , , • • . , 1 , , , , , . , • CD l I ' I i :ii:::i••••.: EO $'E I I }; ,:: ' I, %{'•,}i%y;, iiir'ii + iiir ii >, 7 , •••••••• :::`r: ;•,;;i iii' ' • dill'I 0 , , , ,, . ,,, , • . , ..Lj ; r;rr,. I I.,:i.::::::.:„.t. ,::.::::::::„..e,„„.::::,:::,....,:... , , , , I 17�A w:, U0[{!�/!'�t::✓4i:7%i .f �i'V 4 lr•'%i�i i• , ;%:f:,iiii iii% :%;: %i: %:•:•::•;,;iS r.•; .%:::i% I i.y^ i1:r'{Si$isi::•.•:•ri}ri%'f,,yi:i'.i:;.%:il:�:;:::%}}:i?• i , - �i�Siii�i$itii}iiiy;,r;,r,;r,,;•;•�,,,,'r,:r;:�:'%±:k': •,Lr%r,•r:•,•••xrJ•• 1 ••� 1 1 �'�(�■ •:v • 1 »4 I . y 1 1 1 1 •rf„ 1.1 1 •r✓: I �,j 1 dn i • , S � I .r'r'':%iti%%%'•'f•' 'li 1.=;iii::;:I 1: .,: 1 l 1,1 ii: :r:::::::!::::::.:-::;::,;;;;;;::,;;;;;;:::::::,.%:% : :% i 1 I f ,;,vr'::....,,vffJ,,':,,,4r rr}K« - - ,r:',:�t iii ;,••''r::;{r:•%.•.:•:;:i %%ri'y (} .r:. •:r,•.: .,.< t �I I 4.:4:r'r%,44,;;tiS%44.,„,::•%•'%''vp','; ■ %%r: 1 .Sty',:.' 1 I 117 E f• i?iiiii:;i:ii iii:i::ii;;,:,•,:,:• ,. % iI i 1 ; ' :.t;*•a:a:::•.ii;:,;:;;;:s'''ii i::ii,•::,•.•,• i I, rii% % I ! I { 1 1 ;t'`%'':;:'%';?;r %,;•y,;pC',;:;,v%:;';';. 1 .'. II, r...., .r'.• 'H 4 � � 1 �I r i'41'4:4,4•41.1:••:...,. ~I�„' rh:,i` ; %%•::•:,'i':]r:;:`:,:y:;%:iiiiiiiii;i;1...M.:,,•:':'::: , i �+.1. `E� 7i'i:i:ii`iiiiiii iii..... ...iii: {} • ` „iii%:%:::,,,.....,•.✓:fr•:ti'.:,:;:;::::!:;:,:::; I` • . / r+ 1 i 'til i • 11 1 1 a.1 . . '.tr,:, , . r L E 1 1 r -.. �} 1i r r 1 j 1 I --.i u •, ,.......iyik"`x.:.+♦ 1 ' 4;4 � , Wit,y. r, 1 i w.�,i7 , 'a. "� / 1” i, I . • � �° 4.....0.4.' 4. �y / �. 4 ; I . w r /,sriiFY e a I , w a„■ P • , qpp , L 9. . . 1. I'I t:l 4 1 a .i-71 R ( -22f;6 10 .,.. .—,7 �� 7 A4 0 in 79 it n In �, s ! It i, a, ' 5ft0kt'� f.a or 0 I f 11 • � � � a � . ,~ 0/ � iii`,.91'. 1 , . . ,_.........1.....________, • Z ,, f' w.A p I ! 1 1 1Ci I , ; leis . . , 1 46fIBI >i 1 I, 1 • iZ ft-0 1n--30I4--12 fi B In )I4 12 it 6 in DIC 72 ft 8 in ft,0 in -- 50 ft 0 in---^--^— • a ' jf, .x.wwry.a.'p....:;.- ,. �n�,:ru��,.a-rr-t:ue �.,vw�.;.•r•�:w�rm+w,.•n,+:r'. o..,h,r,.n. .. a-vm-�-• a w; -��, r,-,r ,v ....,.,..._.� — ,_,...^r, , rr ,v,�� - .., „ ., - i q/50; , (,, . .i r 1 I • n ..,• ,.,.., ;,191 � I I I M I j 11 l I isi . ii } • '1 i • 1i � I 11' I T I I u 11 I.1+ - n 1, 1 IW�, —•Z2 ft, 6 jn -- 11 1� 7ft0In- 4-10ft0in il _ . ... ', 1 i 5 ft 0 1n , • +4 --r,,0. Y A!.r� G' i'I 4. r I ++ rrY11 It 1 1 r 1 1 (M 0 t I .■ 4, i ( in A Af+r m f� Q i ., 4 4. 4, I (.: ,' o , L ± . 1 1 . I . , a i i i a , e c '0 { ' I I `� d i i � i i 4 . - 15 fl 6.in� i i i v• 12ft6in--- 12ft6in >< 12ft6In- 3'f4t-----12ft6in 5 ft 0 1n311( 50 ft 0 in E---� 1 • .nwn'•..yrY'c •. ,..br, ,,,,,,,,,,,,Y"Npl--.-",?M'K)K"„M-,-,-,-,-,,-.,.M,,,,--TMY-;v.,yr ri r,{yY Y'nn.nu--,,,,rY,-.»..v--,-•,---,,,,,,,,,»....y'r- I'"'---...r..,.,.r•,..,---,,,rn- Nok.-,..Ir.,... -,,---r.-..,-wr.........fv,.-..,• ■ ■r■ •■fir:s1i.-fir, - • _ ` J Ail■■ ..:-.1111:gr a■■ '`�r+r r-1r . - 1 5 _ - r I - -SIDE ELEVATION - I _ -_ - - _- ---._ - __ - _ - --- _ - - - -- - - -_- - - - _- - -- - - - _ _ .---- _ � - I • _ 11;..)if:'i l " .__ t: , . . , ,:::::::::}:mgiii-1.:::1:::::i:i:i:::::::iimi:I:iiiii::::ii::::::::::,:,i,mgagf:}agoni:-::::::.giai.::::::::,:iiii1:::,,,i,:,-ir::.:.-- t ilt ., _ - r __ — t11iiiitittt i .:•_s__ _______ __c::•::r::" .:M.S : :• �.___ :':?}::'::=i::if} vv:._• stvf__'v: 1.11:` ' %-ttr.'.zilpzilm.— 1"=-111 1 - t�r_U11� =UE ais1 liiii r;n `- • _ 1.1111 - s:prat° .a:, �■ s■ rt s■ s ■ s ■ nit, li .in-olt _ U �lll ... ■■. �raiu atom is um m p ' rair>iant. , animiirt :iieg art■. r--- "' 't i! IN 1.4 4 i i ii la .!!11711 11U>tl, tll: 'lilt Ui i - •_ '-1..---- ..... t • _ : I a _FRONT ELEVATION ELEVATIONS...: ebert - _ _ ',, : : 'cies;:gis He r' u Rern l Flan R 532 The Galena 92I-ate.iMoxrrsort 5-1 l:i3tnf StiY a�€t�►t'iaita k �'ortlnc :Q 97253)22 - 9x26 { i? 94 [,y: $ - Frsg Y�c . . . . . . ' . . , . -- •-.. - — , -....„-- . . _ . • i. • . • - z' '!'' . , . . __ . . . _ ' . • •V.t..--4,-,. _ -- .- - - . . ; _ ... „ . - - -- - — - - ' ' • ' •- . .. . _ . , ._---••-. .. - , • .-',, -: , . .-- _._. - . _ . •.....•.....•...........................................,........•••••.....,.........................•••••••.............• -- - _ . _. ._ .--....--...—•.-..............-.-........-----_.--....—.... ''•--"""'""''''•"••"'"'•"•""'•"•"'"''""•• ' - •■......-.-......-............-.-...............-.....•.-.....-........................- : - - ......::::::,:::::,:::::::::::,:::::::::,:::::,:-:-:.:.:-:::.:-:-:-:.:-:-:.:-.:.:::,::::::.-:•:---:•:,--,:::-.,,,--:.:-:-:,,,--:•=-:.:-:-:-:.,":-:-:-,:::::,•t-::-.:::::it-.-. , _.- ._ . i . i . caw. wir. in klit . • fill lin lit 'wit-;in lit all : . _ II NB man i - ENE'111114,1111i _ 1111 g aTini Si EN.sus win rill.' Egimui - MIR•• MIN 1.-- -4 : - r--- ..--.. : - - - , K _ 50 110 in-- _ >1 I: SIDS:ELEVATION ,.. t _ _. . . , - _ ----- - I ,...- I. , . . . . . ,-- - f •- : • , ' . _ - -- t .,4-77.---„, - ,--- AgneWaggagaleMlgieggtIMIONSIOWNOWWWWWWWWWW- 011 ----. • tr MAMMigkiii:aiEE:Mgiiiii.:_gzii.-iigiEgEMEiga '' I 1111 I NEE" 1 1 ! Mill 1111:11111a114,,;._ 7A-K=3:if,:iliff.:af:.":"-",•"7:"."::_f_Zfa::::..f..:7Kgf.XagtKe.t.iii-A.::=5:-:Kai.k.g.f.:K:g-,Z-Ii.i.:ting-Ki:itk:SE:i:KA:ikt*,-•'...-:,-..,,,,,,,:-;;;;:4,--,zst.:::-:;;,"•-"---:.---•:••••-f----" .--------.---••••:•••,--------,-,-,:.,----:,,,,,,,,,,,,,,,,,,,stx-oc.:.......,,:•:,.......,,,,,,,xt-,, ? ' -- -:1- --,••••,--"----,------",,:x.-1,,,::::•,,,$::::,..:ss."-_-_,_:,::::ggc:::::::-.y.,:::_-_,--::::-SEI:ft:fk:::::::::"ff::::::Wflk-ff:f.tg‘Xfkk:f;M:0.-X;K:KcitXXX:2:::Kg- "...,:-X7kKt3K,Wkiti:KS-0.:3:::::::itZ:Sk"::-0:::::::-KOZS.-;k3Z,Mig-::::*:::.Mt::::::::::::::::::::.;,::05,..t :::::::::::::::=ZO:.:::::::::gg•::::Wgk:::::::::::::::::::::-S77....• , :•• - _,,,,;a4IMMEMWWW`...,,ff$:M.6M,tW.:" . ---L;.,:,-,Z,,::-1.:11::-:•:-.-Z-:- - - - ' - ' ' ' ' - - .•__s ..............,,,..........,........._ ........,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,Totk,•:::-W:::-.MW"......:cf,A;g:::::,f,,M::::::::k:0::::: :?:-M,•::::::::::::Wg.:::::::::::::g•kl.---50-gt:-.-",•:::-W,:•W:::::W:::::::=:::::;::::::: :•::::::: :::•:-"Zgak-F,-,..*:,,,,,,,,,,,,:',---- - ,__..,,,, ...... _ - ; i „,.. _ molt a.. =or ma 41.11 — Si* : ..: 1,*, 111 Aill 1::111/411 lk:11:1LkilliFilliniiirl : . tun-mg illittit nitwit ' ,— . .. . .. i ,;-isiLlio,, „mi. .- , •4_.m, „,,,__„_..„, ....._,...,„,_.....,,. Mit .,.,_illit,,,,OA.1111111-. ; • . 11 , i ;I' 1 . • • *milli .11 - '' ' • ''' 1-1.i Om im iir nn E0 la. -- :- iliiiIIIIII 1, lift,,MII, , I iin -.• .. ,-_ -• 'ii . 1 illii 11111■11.1 LLI III LLI IN • .: .U1116-1111111: - ill101111111 '. 1111111111111111111.. : / ' 1 - :. :.• MIN ittitit ,El RN Ili NI MI I IIII II -. ;: 1 1 lint i ?kin in nn icidn, ilini 6 liar _, ,, 1 .C. . _ 1 , WC 1_1_11 Rif ;I 1____1' II !Linn 4 _._ 1. .• „,, ,. t , • ... . 1 - - ,............_ - .. • -.. = i - , .._ t . • .. : - FRONT ELEVATION ,..,. . A •. :. -4, •• ,_ _. _ •. . . , - • • •• . i = i • . .• - - - .--- - :. • . ---- . : , - — . • — --' . . - , • . ' '•t'- - _ . . .. • - .. • • • . - . ---f- •- .• . . . . . . , . . . . _.. ... • . _ . ,- • . . . . • . . . .. ,,.. . ...• __ .. . . . .•.._ . . . . . .. . . • . _ , . . . . ._. . __ . . - — --:-., •••• ,-'. - . . _ - ..4- - I- : . .. _ _ .... _ . •• 1111111101111111161111 L 1 I I . ._ .- c . ca % r..... rs 0 - :t.. IIIIII ,X-1-- ..s 0 --- , r....- NI, 0 . ... ts .7:-. - hrzsisIMUNITrairgli III rul I , . ..... ,,-,--4-si,../....›.■--_-_,41,1,,f 11,-,is , IIIIII. _-_-_a..s..-.0..t...m.....5.5.,.1,...... : ... q ' 4.tau.,.......,,...w.,....3.,.--,..-,z.1:—....& ,11111 ..*":47-4"CV-'4,1-rt:ii-7-4,4t,tr.74::ritr.410471,1* ,.. I _ . r;--*--\4-,--#X4,.. ---•,,,*,ak-.47,...--*X4 — I II I H I I ,-- AdnaatrItl I -• - .5.p...1.0.il.g...72.-LIA,7.,.,,,--..,,,a a,ogroPaiW.A.0.1,,,.:3:.Kti gte,..,,,,Istit..4w5-;,lagi..s I II 11111 am-zwelmi-v-swalmvissx---Waik;.:-...:-::::_tHqarillilir-4-.N4 , . , .1E-3 ft 10I.5 T_ff..ILO •;- . St 10 ft I - ,- ; - i . . \ 4. ENTRY GATE 1 . _ _ ..._ • . ••, , ,ii• , - . • • _ _ 1 ,. . r• _ : - , - s I • • - 1 ebert , ,-- , _ a Hectors Nursery Remodel Plan . - ' al .1.1 744 ENTRY GATE 15300 SY/Pacific Hiway , _ ‘..•• Rnt532,The GailPria 92:1 SW Morrison Ceecined by: or:e: Portland-,OR 97205 (503)2284926 (503)228-4994 –Approved by: D.0: - _ r :1. - - ..-• ; - .s . - • , . - - . - . - - - - _ _ •. _ - _ _ _ - _ - _ _ '• -I -- 1 -;:?.;;".7 1 -----71- _ c Hectors Nursery . 15300 SW Pacific Hi way • immi +10000.1.1.1.00■11.111r1.11. 4,• f3 BaARt} , E''..''-'..4111111111 11111111111SIF 7 A a.a 1•• 11 l ....I..... Pte 4GE lRIQfiS-' PEMEOCUTARLOGS T_______ ......) la in 1..ar....:i. \ :I.' '• 0 6 :-..:.. \ 1 , F;PdSED AGGREGATE - - -- _ - - - - - - -_ t Mil Ma _ it _ _ 11 _ _ -, . . - EF l - - - - - it rr `_� - _-t-r r 1- - - r s - 1-_' _ i - - -- t - t- j m - - t u -r s 't - - - 1 s - o.- - - r r - - 1-_' t ._ - t - t - r- "c -- - ,_- _ - ¶_ rl E ` tt t � a It I t � y Ft- -1 I;AS t$�!FIfiCECc�I�R.ETE r r �' e _ _a.I. K t i t -I 1 _ t CAST'sd PtACECONCRECE - 1 • t 4 _ t 403•' 4 - -2 ft MO 1 -- Gs IR t 3:Q E 'n— - E n 2 - GARDEN GATE i FRONTAGE SIGN 1 ._. ,. e bert ......________ _,____.___. , Hectors Nursery Remodel Plan t SIGNAGE DETAILS tae: I 'as r •Y. pages No. Aassr a• by Dote: , Portland std Off_97208 (iO3)2284926(503)2284994 99 '1 -- - - - -- _- - - - _• •- . �. .. - - � - - ` - _ • • a5, , I l `"T Y, ). 1 ' ��'.�"'/1,1.: .10);r(� a ., i/i /""'''''..,• • / n 1.'1 �..•.X •.a' - ''.- e itc... , . , . .4 " -' v.1.4 . . ,,,L, .„,.,,.. '.,.....:. -,— ..., 7,7:. .,..i. iiiiiii '''',.; ,.,.- . . 1 • , { fit; t, R 2 ' 41 1... / J t e ! 1 i•�� ! „_ • 1 r --r---, 'rte'' L,•-,� f.`,'--,:•6.. • ,t4.!?'•. t,' ,- .. i/T;J;c1 `1... ifi '} W (-l' i�\i�. r..„ '.l +��I,. J te' M t r,.... ..•-. .rte '11t1'n. . i �. � �Wj 1 r'"� W ` ,.�1.�W i.'�.L. r or,4025 2.- . ' a 1'44 1 „ ,r• ; �' • r Y 'N r ! , ' 4 ti '� . . .. d. , Jl; T..,, -.r.r.y .,,.1"'"^^J.-.,..».r•.1` ,, �o y >< „1,.. ,q 6 at"1$ 1 1 ¢ ' C '� �' x”pY " ry• w ",. . ffil' �• . • 1 '/j✓ ,I:�P.r.a, A.._M•./, „ ,w=t '�"'.''"1`.".1 r-- r rr 1 Fj .J. yT .•'dr- „/1/r. ”' I �r...m. .�.1.. •�, r •; ,i. ;. , . r -`i'. 1 1 .r-- .: �,�5' • 4.r,:,T g' /".-,,4 .i/ ., / �s '.: •1 �' r`+", .S a•.•...1 ,l r 1 1//y l�. i^'N v+ �,,w'r..'"„k, r; r„f i �a r :iy a! r _" ».,y ,+t. °k ''NlGrll 1 j ( 1�• T•.. , ; 1 'i +h ,,• ` y/• J �7 - 1 I ��• 7,"•+�i i.. �...• 1 IV }' j, '. _•� 4,` .-e,a F II t•.�, _ Of ' j�,r�r $ .i 11 �1 i �N,.\j,,. -",,,,)e),".,' �'W A` N IT I; ', Ol /"�"�c,.'...LT -s ri ,,,p,a% •1 ""� b1- 't"."" ' I,%...'. 14, ,„ »-„,„`„, q;� "',t .. `'';''�,,4_' y r + ^\ 41 {'•”1 xG k' _.�r �N PNM ,1 ,6 Y+. A" A� w• . '�I;:,,..,y.},1•,,,s.- / �� i,, ,n,'�, h�r( k• r N`O' `>� ,,�,+ �rC% >G,.)t�.K Q r NfI,' { y:. rK �'r; f r✓ �' h t i _;\ A�7h a©N jr S Y"' � yT C' i , r y q'1� .L'y "y q��t "I�:.r'±Ilwla �F 1 �y s" 1 YYtf S.'r"'"C•te"'••,".'3 1 ,�.1' �t i, �� {�, 1 • :• 3 d 1 a 1^ r,1-1 1 J ■ l J^� ►^ )1 ,. :• 1 ,i 07,10- r • �AL qs,, c A;gr. �• • r X14-{ 4d► 4 . „ID'. " orb c e �' � '�' • a i a IPM :,... r , r' ei �- °, I 1 ff yd 0 eio r.,,,i..A`S\ r w' 1 Xf'+kktly „ V 1 ''`V'` djT yl�hrpl''.,1' IF; 1 •a:xv'1..t;n r, rYn+ .4,kw �!{,r byp c.,irrYHf' .•. •i 11 '.P` ,' ', 'Ala 1 4y,�'i ".f.' ♦ 1j11 .-01v , r'A a . yn„ (• r , ti. �� !�,. �' r �..r, I•,. r, •r iT.. �'.7i". X1 Ctf.i�..�nr.,' ! ��• � �y �� r /Y Y rj �- w .Y r r , ;'lC3.'dtl..., •,•sr q,, ; 1•'"•f•'( wi • i R "25 1 4 5 +,.• :7. r.!.'1,'. $G"r . 1 1 , , ,E2.1%',. .. ,•• g$1,• , ,,.\\\ ._1•J .4 ,..'>�..� e _' 04•1t rwr rut . . : .ti, ,a• . gi i,C• 11 " 11 --ff 'k 1"J u" A1 ,,∎1'4:4' :4,,` h y r dip j e r"`f » „-. i .A. ' N,I! „•. �'l `mss,.• y.'Y",y 1Ay 4 4 .A.,...,..„:r1'1 W t. x , tea" r J r' 1 4lF ''• ...,2-.,:'""' tf H tY,9,r*' /k•1/4? (i,_,'"< ' ; : r• iP•-4•164-- '• ' • •'"" " ,':I'.-6 i:I: • •• E"" r 1 k \ iM 4k' r y r yr i ,, ..,'... - '.-,$ e.��'1 '. ,' ii: I.. ' .,J��. �.,— S. „!!'` k' _, . H '''`t! 1. t a •-� 44; ^ i__'4.1"'� 4 `"1.1„ - t ,'`'j\. '�I j,,,(j' •.N ,is 4 .',i... �..IT ., • r.YiA �� w " '" . .r k nl 1 IL: .. . ,ii ir1 I/r, I h� ' „.,,lkk �1 i 11' �I • ri ,l AV1• 9,y ( {f '1.. .-.r,w.. f ' • F,. ,,,,,,j At If } A ilil:/ / r'"„� ' Ktrti'�1.. T'i"J'"r•'}•T r« n F L: ø :1' '1) . r dttl Y N r I a ,. t;.r /� yl, Y!' r Iv,- x,i t'� ' '{ a.. a 1. 1iy'b 1,. �'�` ... ,' �.', I r.. » M r, S' yY P r 1 •' �ir.l�•w r i a 1, "J., :W �•«.' y r,u ua'•-� ,� / r 1• .-Y 14 _, `I ,i."a'�i..'y OS 4 ..«.....•.,.. j ..... •Yi:.....,,..,.”-:.1 Si 4111/.,.,A h 1 'A, j• ti4'y .. , J °-wu • 'Ixw,t rv.tie' 4 , ' 1 ' 1 1 4."4Y''' ' • ' .I` r „ t,^�1r• "r'j t 1 1 1 1 I'+/2 LYIMdf Ol t 1 ( � > 4 A •,,,u- took ',' f ' .v.lL.- w, , f 3 .I.' "e'''' 1 1• l ve. "1{ rl Y ' "A W 1 }} j 111` •Ner ' � , r V I , ".Y J�I.I Yy i kx 'y( r ^Y F 1 ` << ��ri�..1, 13125 S. P. HALL BLVD. 0.-P.-° 29 3988 P.O. BOX 23397 TIGARD/ OR 97223 II " , '' q3,147,1,,,,,, 1 , OREGON JUL 1:19 ,___,Z2z,L, AiGht(e.4-2,-, TO: . NG .,,,....j, 0/2____._,,,. „2„.,- -,,,,„ ..,i,,4.1,1 ge kw -. innitaeo„, 4 1 efipi, ,, '11'k, /ddi t:g1,114t6Z, '. ' ic...(t, ,7 Ai-c-rra-;e..., ....._&'- 1. ' .M M?�MAnM f fi �tw^ . � �' Yom' .�� ,r. I:� ' ; 1 /' 'f.+��"�d 06/ / y� �;, v� ,/'di ,ryg�y�� 'r • ft.� 1",� � I "fig *' I 7�rY. ,�'M'" . wt" wu: ' r,�r ,j + I, ,+ r'N { :� ��?�1�� , tl'A . .4i. te,..L6!,_2_46,t, ae,,,ced„, he / ' Sa4gil-ial . z/9' fr '''' • *. i. p. i , • ww........w.wtirra.rw.+,.rr...i.A.Aw.:....wr+.+M .. ,-. -..,.- -. .,...,w��,�,. � ,,.�.ra - .. � � !.'.T-�,.w.:..+++.'wW.ww+,�.rMi'...+e.+.,...4�-kw.wA,.W.r+++•� ,., ....,,4•....- :._ „ .' �� ,� �,� .�,,.KL..,�.�...1„y ,'.. ,.� �, 'ww..�n�,; W.. j.�. '.+...�i4L.Wr , ....: � ,+. - __ rk.w.J..r.�w..N.l � V'�+•?Ww�'.��f • i.**AtAl••••+M+:l....w 1*....:rr 1 �)• ? iW„i.i,.1' /n:A✓rw.�WF.•::N4:.r..,w:.fr+n.l+�.:...�wn.w1 ') F.wrew �''...±..wl:iry'r'M�w1LJM'+4�ia5lwM1'+'?.I.w4WYr�{4.Fi�+IY�Aw+yl ,r+�LWw. . r�i.MwliwY.eii y)wrtiW uW+y X41.' �� ' '• a....ww,.awv'.r'...isw+r•.�ri.r,+,a .. w,L At REPLY .__. ._,11...____ • 2 f�'i C tj..✓. ' 1 l•`� �a C� +l i, "1 ,, tai ' y .0 J vv‘t. 4 ,' . ... . . d-G J e• 1K1 +a1, "'. `rr t_`J� ._...� 'f1'S 244 04.7 IC" ' ,., ,/g'//W , .�C �.. ._. ,.,/ti' er.'1�w .,�,... I c_l_o_si. t t, et/e_2,/ L. 4.),.., 7fc,/ 1,-.e.,Q./ - . '� SIGNED ,... �. DAT �AXi 6��7 !^S/_ PLEASE HETUHN ORIGINAL COPY WITH REPLY. KEEP PINK Copy POP YOUR RECORDS. ORIGINAL 0 • 14‘ i I 13125 S.W. HALL BLVnv 1' .�•r .. ., P.O. BOX 23397 CITYOF TI T I G A R D, OR 97223 (503) 639-4171 F.. OREGON! • , + • r won.l.err.l+aw.mal.nw.r � - ' � 4'� ( wk"• �« �, 29/t/t:/V . • L..o...b. f' , • • r r Jt, w ;,'• ,• V ��.�'"� �W' t/'� S iW,�,!. .r Rrr7wA4/'n� '�J I W w� �,5^ ,�,/ /497/4, ,. ��.,` '' r ' ''_ "7 1 ,� • r ic) i , ,'H��r�l•�x n�.r�"1"'�, " ' I•' , ,'f � �r,✓ �f t, r w.�rLw�,.wr"rr " , w M "ec,r /764,6„,"jj+ / 'w! ("e4 4w✓"""''6 1��"•7,.!"'�tt'1 `'S..• r,�'`r �'6•�F+^[ ” ',; '�• ► f Jr ■ • � r � fLwWrir.�r r ,/rur,,..LU � i•"' 4rrr �n,•1•,��1�+�,• ... ( 0 " 1 SIGNED W u��..':.:. 1 DATE" , REPLY I I , 444 1 - «•r.r,�rru.r.rr.'.n , • • a,: r l r • • SIGNED DATE ' • I PLEASE RETURN ORIGINAL COPY REPLY, KEEP PINK COPY FOR YOUR „ FILE COPY • I PS r r 1 r •,f 1 , 1 r I / V ...,.t ,........u.,.....,, . ..,- .......,.a..-............nL,.,.,..,,»..91'i...:.....-.a_. w.. .,,.«...._..... ....m.. ,......n+ ..mow,..., _,...i..:i... .«....._. .,., a ,...N.,....«»,.-,.w.we...,..«..._.wu..........w. ,._........ .H.wJ:v....... .r , , *�k..n ■ F1t �'"' q S I G+.,drt i t IN k c�ral C dGnnm�, r c.Yl 4 REOUES ' FOR COMMENTS • TO: DATE: June/ .i 198: "; �:»..r . �• 'W I FROM: Tigard Planning Department "., _,., �. ,' � . RE: PD 88-03 SDR 88-13 A re. est for Site Develo_w t- ' ,Qw 'anb_ m a l_,••t pstruct a new nursery retail 1.22iLlin9 and remodel an' existing hQus nr.; - . shop. Zoning: C--C (PD) General Commercial, Plann. , t *cu.- a. . •: 111' 15300 S 1' Pacific Hwy, (V CTM 2S1 1ODB, Tax Lot 5 :... '... Attached is the Site Plan and applicant's statement for your review. From • information supplied by various departments and agencies and from other t • , . , information available to our staff, a report and recommendation will be _ prepared and a decision will be rendered on the proposal in the near future. 11 you wish to comment ca this application, we need your comments by Tune 24 , 19 88 You may use the space provided below or attach a separate letter to return your comments. If you are unable to,�resaondlhe above date, please phone the staff contact noted below with your comments and confirm your comments in writing as soon as possible. If , . . you have any questions regarding this matter, contact the Tigard Planning '� Department), ��Q a Box 13125 SW Hall Blvd.,mod.p' T Tigard,and y OR 97 223. Phone: ' r . 639-4171. . STAFF CONTACT: Jerry Offer . • PLEASE CHECK THE FOLLOWING ITEMS. THAT APPLY: • ,. . We have reviewed the proposal and have no ob j ections t o Please contact of our office. Please refer to the enclosed letter. x_ Written Comments: /,/L!I✓i f1!A'�G l:�s4:1' " Y►iVp/ice bh!L _&;4 X41-21./ ' s e , I / X a r� : Name of Person GamMentf,n,g..d- Phone � o. ? e --rG C, � .= � ' Ch/3521P • R REOUEST FOR COMMENTS TO DATE; June 15, 1988 • FROM: Tigard Pl;nning ►.epartment RE; PD 88--03 SDR 88.13 A request for Site Developme. t r .. • a7 trra r.ciastruct a new nursery retail buildim and remodel an exi„atinaj aQuae l nt-: _ reha n • shop. Zoning: C—G (PD) General Commercial Plann-. ,- - . m-, , : °,, 15300 SW Pacific Hwy. (WCTM 251 lODf, Tax Lot 500) Attached is the Site Plan and applicant's statement for your review. From information supplied by various departments and agencies and from other information available to our staff, a report and recommendation will be prepared and a decision will be rendered on the proposal in the near future. If you wish to comment on this application, we need your comments by June 24 m 19 88 . You may use the space provided below r attach a separate letter to return your comments. if .ru are' �nable �. ito res and by the above date, please phone the staff contact noted below with , your comments and confirm your comments in writing as soon as possible. If y ou have any questions regarding this matter, contact the Tigard Planning Department, P.O. Box 23397, 13125 SW Hall Blvd. , Tigard, OR 97223. Phone: 639-4171. STAFF CONTACT: Jerry Offer PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: ° •We have reviewed the proposal and have no objections to it. Please contact of our office. , Please refer to the enclosed letter. Written Comments: • d• • 111,7111111r • 'Nave of Person ropmentirgr � �� . Phone No rah/1521P ",. , fir, Y •,. •. ,••, , ,• ' • • .e rv�..w.-.n._..4 r. r....,.,. .A,.Jl,...4'..._..„..e•....A.:,,........., .. r.._ .4,...... -Y.._...,.t4_'.t. : MEMORANDUM k .. , ' CITY OF f..a i;AR , OREGON ' 1 ..ro: CF r'rl+y Offer, Assistant Planner r June 27, 198 ' ; � :F OM: Cary Alf son, Transportation 1n in ei . , suixcN; PD 88-08, ,DR 88N1 HtIcatt0r,1 $ 111urr,s rwy • 1 P.:,rrd i,nc,,1 5: + The subject,. site frontF on Pac: fic Highway with two existing driveways.a Pacific Highway i$ under the jurisdiction of t he Oregon State Highway r„ 1 �^ a- D:l.117,�a,l'Jr"1 �.:�7 � rf ,r� r�r'F`r� � rrr�ir� t�t P,t t�'t� ��r� !�#o9 C� 4:. � r 21 Sanitary sewer exists approximately 500 feet south of the site along Pacific f a r w J �w� y 1 The site'lr presently aH in bathroom facility with., se ra t i.r; s./ I'm. wl"17t' remodel w f117Y rrlr; ��tta tr:ftl3'1>a.r~�r't ta.y I:ara ltr' m fear, 1 i,'t.y..' ►p us ; i �,` r . nt' e�411IJP 4�.C." %fix)4 i,"�'� �r�� '"0a'1f', �r4=ts.4.''N liixid i��k'('t� e, 1X Hie l'Jeiiiviic'Arai 'Clr'rY ,or r 'Wolfe ,, ' ,,y,,,x 411 M Rix 'xu r phi 1t Itrvti of te'.° ,�r � .x A?�� tut, k?i7;�r�t' •r n7 IAI �'° � Ca� �'i��"�.'c1. R/ &C�P71 1'n�t�� C�Stt��"Y1 /,{"1�'u,�4 1 3 1 The. $it to a,s :r loped to tie s out:" r ait 1 to 2 percent't, 1 he pr«oh�o;r0d r,)1"0 j 0.C ; 1, , wiJ�..11 1 polite and>rr�r;ft 1��+rrr pat r i;f j�I`tyy1'rr� rt�r:r.: l i,rig Gfrr�atr�c:i I:artr k i,ri t�otr wh:1ch wi l ll :trrcr^�4 t� ! rrtl.rr`1 G1 r I from the site,V 1 ' Conditions: 1, The applicant shall obtain ra permit, from the State at of Oregon Highway Division, to perform m 'tonic within the right—of—way of Pacific Highway, h cop;ay. of the permit. ;3Ii �i,:r be provided i:;r»� the City Enut i1r�eerN�i.ng Office prior or to issuance of Public Permit, .r The applicant shall obtain a �y r W 1 approval�� fi t 7 the Was tir t or County <r. Health Department to utilize the septic system Gur to issuance of Public Impr'o. teim ri•1: Permit,:. 31 The applicant shall provide for roof and N r, I r., , „N 1 < �f �artri parking�Ir�� lot rain��.lr �ar��c:� to s H1 the , public st:r;)r mw�at:k r' drainage system or by an approved' � b j 1 "140 system designed to prevent runoff onto the adJacen1. property, rty, i e';' '(;0?"-- e//e,'” (''''''e N a r, r,ocll, .HH +NHNHi1W1}NINIIYgfIrINY1HwrHrHINHHrf.IlN1.HUIWIMHNNNW/rYNN11NWNH4rN1u1NHN4NIN111.HIM111N.rNIrruIUNNIWiN.H 3..µMrIM ,NN yi�y' ` Randall ' Woo ly, City H rl itr rl , fir`/! � 49l , ,Rr . a•, (7), REQUEST FOR COMMENTS TO '1'6 V r / i DATE: June 15, 1988 FROM: Tigard Planning Department ,. RE: PD 88`03 SDR 88-13 A re est for Site _D velo rust a new nursery retail building_a0 remodel an . . �. Zoning: C-C (PD) Gan eral Commercial Plann �- �..,,� : 15300 SW Pacific Hwy. (WCTM 251 IODB; Tax ,ot 500 • Attached is the Site Plan and applicant's statement for your review. From information supplied by various departments and agencies' and I f rom other I information available to our staffs a report and recommendation w.111' be prepared and ,a decision will be rendered on the proposal in the near future. If you wish to comment on this application, we geed' your comments by June 24 , 19 88 . You may use the space provided below or attach a separate letter to return your comments. If you are unable to respond he above date, Illease phone the staff contact noted below with your comments and confirm your com1 ents in writing as soon as possible. If you have any questions regarding this matter, contact the Tigard Planning Department, P.O.' Box 23597, 15125 SW Hall Blvd. , Tigard, OR 97223, Phone., ", 639-4171a f;, ',dTAFP CONTACT: Jerry Offer :. PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: �. , We have reviewed the proposal and have nJ objections to it. Please contact of our office. Please refer to the enclosed letter. • Written Comments: ,y/ t J�wlf Name of Person Commenting: Phone No, w 1 t.n/3 521. • I , tr •1 .. .._ ...,...•. ..... ♦...„...n.....,...a.J4.-.1•..,.......+—..n..,J....... ...•r._n_•....«i..........-.•... .M..,w,...+ Y5•.nn w,.nn rr.lm.=4.,.,.M ....rn.+..+W .—.-4.....'..w.k.u..«.r..,....5.......N.,IaL.+ ,r„ . .'a .r.,.. „ r5da,•f MtiDr',f.l:.+k sag ..J' :'h wad' ./a + , L, .0 REQUEST FOR COMMENTS -.,„,„ ' •-'-' - c. I a juN 4 1988 , .. . TO: I DATE:: June ll PROM: Tigard Planning Department $ ;;a i DEPT RE: PD 88-03 SDR 88-13 A r • est for Site Develo;�,;u,:-r. ,t-, .•,•, • • . .••- ruct a new nursery retail buildin• and remodel an e ; - ' la s. ' ,. shop. Zoning: C-c (PD) General Commerc l. ' spaos ___t.00AT 1; ' ` 15300 SW Pacific Hwy. (WCTM 2S1 1ODB, Ta_e tat 50, . Attached is the Site Plan and applicant's statement for your review. From inlormation supplied by various departments and agencies and from other . information available to our staff, a report and recommendation will be . prepared and a decision will be rendered on the proposal in the near future. If you wish to comment on this application, we need your comments by June 24 , 19 88 . You may use the space provided : below or attach a separate letter to return your comments. Ii ou are unable to reapetind by the above date, please phone the staff contact noted below with :" your 'comments and confirm your comments in writing as soon as possible. If you have any questions regarding this matter, contact the Tigard Planning Department, P.O. Box ;3397, 13125 SW Hall Blvd., Tigard, OR 97223. Phone: 539-4171. STAFF CONTACT: Jerry Offer • • . PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: ° f, L. We have reviewed the proposal and haveno objections to it. .• Please contact of our office C IVE • Please refer to the enclosed letter. JUN 16 1988 Written Comments: , V. i iii, 6 0 1 `" G "1 e.„ a ''—,-a. f Via.. mod--Ca:.r.r 4 • 4 , . .- ) ± dam--'t.,,,_ , .. ----4--,ma_____, 6.___ ‘1&___ 1..-______° 147ff_____,44—____<L2L.L.,_ezto do) coeitloaCe.. .6))--e.-.0 ' ..r.... .z..._.15.1.14, 0 _ Cyr,.w • - )•-.1s . 2:4440 ____: :• ,11.31...,---___s_kgri_sr........:4,CA., / Via. H • ame of Person Cotlmentin s t g r Phone No 2/ 4 n . . 1) • 8, VST rft REOUEST FOR COMMENTS 4 -) Ju TO r 1 r DATE: June 15, g 198 L7TroF FROM: Tigard Planning Department NA,/A,PLA 1-1WIRD "tv 1VG DEpr RE: PD 88-03 SDR 88-13A...2for Site Devejsmga .•• • • wi ruct, • a new nursery retail building and remodel an exi,itjagjagausadato_a_ratail_ • • - shop. Zoning: C-G (PD) General Commemialt_all2emeackoaeat_LOCATMLN: • 15300 SW Pacific Hwy. (WCTM 2S1 10DB, Tax Lot 5.0c11 Attached is the Site Plan and applicant's statement for your review, From ,• information supplied by various departments and agencies and from other • information available to our staff, a report and recommendation will be prepared and a decision will be rendered on the proposal in the near future. • If you wish to comment on this application, we need your comments by June 24 , 19 88 You may use the space provided •. • below or attach a separate letter to return your comments. If you are unable . lif,LInIpmilax1112.21?2ye date, please phone the staff contact noted below with your comments and confirm your comments in writing a.$ soon as possible If • you have any questions regarding this matter, contact the Tigard Planning • Department, P.O. Box 23397, 13125 SW Hall Blvd. , Tigard, OR 97223. Phone: 639-4171. STAFF CONTACT: Jerry Offer PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: XX We have reviewed the proposal and have no objections to it. Please contact of our office. Please refer to the enclosed letter. XX Written Comments: *•••••■■•■••..........*W* There is an existin. 12" main in _front of_Le.ht_property along SW Pacific Highwayl_ However, with this 2212.s1on, additional fire protection and meter connections must be made. A fire hydrant will be required at the most southerly point of thp....._.2E22frty_2E_Paofi Hi hwa (tstimated Cost: $11500) . Another meter shallbp installed 1 _to paredlelthee)cisteter. This new meter shall be either an . , . 111" or 2" meter, depending upon demand. (Cost; 11/2' = $3, 000 or $4,800) Name of Person Cominentingt Robert L Santee „/- 40, Phone No 639-1554 (n/.3521.1, • ,:c4V 9 7 'I • • 1177 ti ECE V� RE'�:,I, T FOR COM 4ENT�i, , 1 j U N 2 0 X198 , j T . /� 4 DATE:,�, L. ., , � June ,15 1988 FROM: Tigard Planning Department PLANNING DEPT, RE: PD 88-03 SDR 88-13 A request a for Site Develapmen• - - ... . ,: . - rust ,. a new nursery retail buildin• and remodel shop. Zoning: C-G (PD) General Commercial, Pled h F2eyelo n C/•1A.T7(ati 15300 SW Pacific Hwy, (WCTM 2S]. 10DE, Tax Lot 500 Attached is the Site Plan and applicant's statement for your review. From d . information supplied by variouo departments and agencies and from other . ', x f a ion available to our s aff a t and recomm nlat!on will g,. information �-a , r� eor eat �I'1, be � prepared and a decision will be r�ndere., o, the proposal in near future. If you wig to comment on this •app• ration, we need your comments ; by June 24 , 19 88 . You may use the space provided ; :. •: below or attach a separate letter to return your comments. If you are unable to rq225111J.L2DLIIMEMi1152.2. please phone the staff contact noted below with v -, your comments and confirm yo;,-° comments in Writing as soon as possible. If you have an y questions tegarding aiding ,this matter, contact the Tigard Planning E Department, P.O. Box 23397, 13425 SW Hall Blvd., Tigard, OR 97223. Phone: , 639-4171. " + STAFF CONTACT: Jerry Offer f A PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: We have reviewed the proposal and have no objections to it. Please contact of our office Please refer, to the enclosed letter. Written comments: I . g' yak vl4wrl ,r.�rrmrrr r 'Y�rwrr. i i e Name' of Person (iommentin : Ph''e : 6"I,e � tni/352 t.l, . , r ' 4 • ® e • D/1 REQUEST FOR COMMENTS k .sciERAvir, JUN 2 4 1988 /I) • TO: 1 / Irat ) DATE: June 15, 1988 , Oily of TI RD FROM. Tigard Planning pup, PLANNING RE: PD 88-03 SDR 88-13 A re• est for Site Develo z- . - rova1 to_construct a new nursery retail builda.nq and remodel an existiIlg 1.K2u se i r► _o rata shop. Zoning: C-G (PD) General Commercial Plann-• ..,11,-• O. A .. 15300 SW Pacific Hwy. WCTM 261 10DB Tax Lot 500 r,. Attached is , the Site Pl an and app licant's statement for your review. From ' . information QT,wpplled by various departments and agencies and from other information available to our staff, a report ; and recommendation will be prepared and a decision will be rendered on the proposal in the near future. • If you wish to comment on this application, we need your comments ; by June 24 , 19 88. You may use . the space provided {, .. below attach ch a se arate letter to return your comments.e nt s I f you are unable • , • espnd to d by �h� abm�e d ate please phone the staff contact noted below wit_ �• your comments and confirm your comments in writing as soon a as' possible. If you have any questions regarding this matter, contact the Tigard Planning • Department, P.O. Box 23397, 13125 SW Hall Blvd. , Tigard, OR 97223. Phone: fi, 639--4171n I STAFF CONTACT: Jerry' Offer � � �� :', PTJEASE CHECK THE FOLLOWING ITEMS THAT APPLY; • II , We have reviewed the proposal and have no objections to i Please contact of our office. Please refer to the enclosed letter. Written Comments: • � „ ��✓-.- ,K...:rif,�' J. . . �..•b14 � ..ill ` .�:�.:: �. ...._._. NtM4 of Pere$n„. CoMkeitiC . !il.,A�:•. Alatek. .. � I �: � I ) ) • No a Phone Y - 1 ,,, ■ i , 4: riwi REQUEST FOR COMMENTS ' d\11\\....)) TO: r i DATE: J t.,' FROM: Tigard Planning Department i(ptO RE: PD 88-03 ti DR 88-13 A re est for Site Dewelo.amm y .a ev � .��anstrtact t ' a new nursery retail 'buildin• and remodel an exiisk. 'na p':« ;n::;:avail g shop, Zonin : C-G (PD) General Commercial Pl aa ll2nt rbmrr ; 15300 SW Pacific Hwy. (WCTM 2S/ 10DB, Tax Lc 1/�N/'�11 Attached is the Site Plan, an d a pp licant's statement for your review. Prom information supplied by various departments and agencies and from othe ' information available to our staff, a report and recommendation will be prepared, and a decision will be rendered on the proposal in the near, future. If you wish to comment on this application, we need your comments by 19 88 y June 24 , _ You may use the ,s. ace � provided below or attach a sepa.ritt letter to return your comments. Iu' are. unable to res w s �h� abce dates please phone the staf f cOntact noted below with your comments and confirm comments in writin g as soon as p ossible. If you have any q uestions regarding this matter, contact the Tigard Planning Department, P.O. Box 23397, 13125 SW Hall Blvd., Tigard, OR 97223. Phone: 639-4171. STAFF CONTACT:TACT terry Offe r x r PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: ></* We have reviewed the proposal and have no objections to it. Please contact of our office. Please refer to the enclosed letters Written Comments: ft Name of Person Commenting: .',.1' AAA Phone No, o ailel, �r „, 011/352tp e t REOUEST FOR COMMENTS TO: 1;t4s4� DATE: Junfr5I12A?, •_ � �� ,r�1 TIGARD FROM: Tigar• Planning Department PLANNING DES Rh: PD 88-03 SDR Site Deve1cvment:_.R_evv'. a. . . • • .. 'ruct a new nursery retail building and rent el an shop. Zoning: C-G (PD) General Commercial, Plann-. r,,- - •.,u • ; •, 15300 SW Pacific Hwy.' (WCTM 2S1 10DB, Tax Lot 500) Attached is the Site Plan and applicant's statement for your review. From information supplied by various departments sand agencies and from other information available to our staff, a report and recommendation will be prepared and a decision will be rendered on the proposal in the near future. • If you wish to comment on this application, we need your comments by June 24 , 19 88 You may use the ' space provided �- �� If a1J! are unable below or attach a separate letter:to return your comments. .W.._J . • to respond Eby taste above date, please phone the staff contact noted below with your comments and confirm your comments in writing as soon as possible. If you have any questions regarding this matter, contact the Tigard Planning Department, P.O. Box 23397, 13125 SW Hall Blvd. , Tigard, 0R 97223. Phone: 639-4171. STAFF CONTACT: Jerry Offer PLEASE CHECK THE FOLLOWING ITEMS THAT APPLY: y We have reviewed the proposal and have no objections to it. , Please contact of our office. i please refer to the enclosed letter, Written Comments: • i i i YID' Uatne of Person Commenting: Phone ne tdo ■ CIRCULATE i • B '� RC; JO Iet i Staff Review J tOe 1117( CITY OF h LCARD ... COMMUNITY DEVELOPMENT DEPARTMENT PRE.--APPt ICA'tION CHECKLIST • Date 9 Ip PQ �G , APPLICANT JL( N2S&E/ r `'e `-r- 2, PROPERTY LOCATION g9iq 5 ,- 4i Address 36 � . � 1f Tax Map/Tax Lot �� . „ 3, PROPOSAL DESCRIPTION/NECES AR`s APPLICATION(S) rat 4,e'A v< . [. C fro. s "0 j, • 4, USE Ex i.sting :. "� � � Ad j aceht Property , 11 ei south ' + � 1 east Vara west "��e� d F f. ` 5. COMPR! N EN IVE PLAN DE$IGNAT:XON ,� � /01')(.. (1,1(4)//..VEIL____.,04,74/h.. 1 6 ZONING DESIGNATION G I /, NEIGHBORHOOD PLANNTNC ORGANIZATION NO, , CHAXi PER'1ON HA I� �,,-�� ,�" P Zvi CO O5 IR E U�C I��:M E T�{N ,. 7 Mihitnutts lot si e/Width i A ' Setbacks rt��orit �9i" �w cotiier �,�� side, ' roar /IP 4- 17, ilelitr Special setbacks: streets ;1 t galti.4:1"shocl are►as lower Triter ity Zones , Wetlands flag lot accessory lot lihe YW„yyy N o e5s r 'struot�res zero o of 14aximum lot co ver . " a k i mutht buxi r height } • . � lu +.L'_.A«✓a._..�........u.to r,x.n rt.,,t.i.,r«..i w �..r.� �..,. .w 'Special height limits flag .lot. ----- other ..--- .... , " Density calculation h.---. ».� . .» w»_» Wes...».. .w....» ..._. . ». • Density transition _" Landscaping: minimum % of lot area .. % g «c 1 ' 45..Aoad k , street Trees J 'nil 4)Ui4q �W` r ' ",�, n}• , � 0,�, .' '—' �, ``� .,•, 0`�` 'H,'e .� r . Buffer Areas ,...». .w, Parking Areas � Y c t....: ` t � ii4 e14: ; , C � 1 'Visual clearance . � �� .' t� Parking and loading 2 G gi , a U,e / ` I b! k old �� , ,a c � � »_ �W»». W» _ Access and circulation ' x t�.� -� c �e .. "iw et' r._ :,'ii.( /t, / • signs __.,,j -fiert-c4140,z1;ilei,; 6/4 A 4/A Wed, 74'',.•14,-.C./7 ,oeLt.":4,11911 448,, 4.71,04/ orey",/-01/00 . * 9, OTHER CON,,XDEPATIONS (See application checklist for specific items) Sensitive lands: floodplain . �.:.;._ 'drainageway . 25% slope :„,_ , • . Wetlands, .:._ �~~ Open, spice Historic oviP'1y -7-7" . Street 1.rrrprotlertrentsiconnecti ins/lei.keways , 4»:., fil»..:' ''e""r¢*? `ir s" ance,.� `;�"` ��'� ��r -' ..,..44,- �3�}�tI rc i,.,, eep.t�_____�t ./..4 ;F ►. F r C i Cie hltui, �� 4, �„ ;1 ; en,/0 . _ 1 . . Right—of—way dedication (1 1: Sanitary Sewer improvement »_»b„.,t1,,,e/Le,PLI rC.o r ),1,/,2_ 71.,...„.„,_ r , ,, ,sues, Storrs Sewer improvements 4'v/ell, - e;, si-- i ;» 1,,drep'kutle Or fee eli l( ti `e' r, Ir roUemant Agreement Permit; Bond s ees ,...�.�..:_ . • � » -♦• NwwNM»wl v .,. � _ , y..�.:.» ,_ .. .»✓•»' w.'Mw»wrr»»:r1.riNi.V " � other ag enoy permits W- - — 10, PROCDUR Administrative staff review � . Public Hearing/Hearings Officer � lw„»,w,ry,w r.�rrlw...•..k»...I:.. , Public Hearing/Planning Commission e� _ r • • 1 The Administrative decision or 1, Public Hearin g shall Occu approximately at dayS after a complete application i s filed , • 4o-day appeal period follows all decisions 1 (O57 P/0022P) • • R Nu Mme;, • • St;,,ff \I 0/41'" Date " .1 CITY OF TICAR® COMMUNITY DEVELOPMENT DEPARTMENT APPLICATION CHECKLIST The items on the checklist below are required for the successful completion of your application submission requirements. This checklist identifies what is required to be submitted with your application. This sheet MUST be brought and submitted with all other materials , at the time you submit your° . 1 application. See your application for further explanation of these items or ; call Planning at 639-4171. ITEMS TO RE BASIC MATERIALS INCLUDED A) A pp 1 i cation f o rm (1 copy) E-I D). Owner's signature/written authorization [-11 ' ,. C) Title transfer instrument Ems" ' D Assessor's map Ems' E) Plot or site plan F) Applicant's statement tement E (G) List of property owners & addresses within 250 feet C � (H) Filing fee ($ ) C [ Avia l :t ' , i, e SPECirXC MATERIALS A) Site Informaon show � i �ti ins (EVo; of copies 1) Vicinity Ma 1„.3:- 2) Site 'size Map [,l, . r ade s > 10% r lines (2 ft at 0-10% or 5 ft for 10%) C ) Contour 1p � ,, �,. 3) grades •w. 4) Drainage patterns, courses, : and ponds [ ] . • 5) Locations of natural hazard areas including: a) Floodplain areas E 3 ] ` b) Slopes in excess of 26% , C c) Unstable ground E ] d) Areas with high seasonal water table [ ] - e) Areas with severe soil erosion potential f) Areas having severely weak foundation soils ' 6) Location of resource areas as shown on the Comprehensive Map including: p in,entory y g a) Wildlife habitats b) Wetlands 7) Other site features: a) Rock outcroppings b) �� .,,l measured 4 . ' Trees with � + caliper feet from ground level E " Location',of' existing structures and their uses C' " 9) Location and type of oh and off-site noise sources 10) Location of existing utilities and easements [ L-3'" 11) Location of existing +��a�s xsta:n dedicated r�a.ght�-af Cwl • B) Sie, DeVelapment Plan showing (Noy of copies C 1) The proposed site and surrounding properties .: 2) Contour line intervals t4-3- ) The location, dimensions at'Id names of all • a) scisting & platted streets & other pub)is ways and easements on the site avid on adjoining t,3' p rop' erties AP 3 I C 1YbN GHC-GRL IST Pag e1 fi • � 415 b) .roposed streets or other publi( ays & easements e on the site. C ] c) Alternative routes of dead end or proposed streets that require future extension [ ] 4) The location and 'dimension of: ' a) Entrances and exits on the site CL°]" b) Parking and circulation areas C�] c) Loading and services areas C d) Pedestrian and bicycle circulation E ] e) Outdoor common areas, C' ] f) Above ground utilities I ] 5) The location, dimensions & setback distances of all: a) Existing permanent structures, improvements, utilities and easements which are located on the site and on adjacent property within, 25 feet of the site b) Proposed structures, improvements, utilities and easements on the site C 6) Storm drainage facilities and analysis of downstream,conditions C � 7) Sanitary sewer facilities [ ] 8) The location of areas to be landscaped -]"" 9) The location and type of "outdoor lighting`' r.. considering grime prevention techniques C ] .. . - 10) The location of mailboxes E ] 11) The location of all structures and their orientation [ ] . 12) Existing or proposed sewer reimbursement agreements [ ) C) C,rad in Plan (No. of copies ) C ] The site development plan shall include a grading plan at the same scabe as the site analysis drawings and shall contain the following information: 1) ' The location and extent to which grading will take place indicating general contodr lines, slope ratios and soil stabilization proposals, and time of year it is proposed to be done, C ] 2) A statem ent from a registered engineer sup. ported by . ' . data factual substantiating: a) Subsurface exploration and geotechnical engineering report C ] b) The validity of sanitary sewer and storm drainage service nit.oposals C ] c) That all problems Will be mitigated and how they Will be 'mitigated , A) Architectural l D�aWi (to, of copies __±I_) ment plan proposal shall inc 1. a site �'lo _ Th depglop p „p q footage of a1�. ' ) structures ed for Use Dore'�, Floor plans indicating ructures pro ose o a ;�square oh—site; and C "' � . Typical elevation dr"awn s of each structure, E) d sca a Qia The plan shall at�th same scale • n �No, o '� �" a p p� h the �o� the site analysis a liar scale if necessary and ,shall plan or larger ' . indicate: 1) Description of the irrigation system where applicable C 2) Location and height of fences, buffers and screenings' [ APPLICATION CHECKLIST - Page 2 ti '+x ,r » .Fl„„ . ,r,x •rNa S74♦6./.1^f^'i 4 41,6,4) W 4lh1 , ' I r ', 3) L . , ) tion of terraces, decks, shelt��,w,, play areas and common open spaces [ ]. 4) Location, type, size and species of existing and I pro 0 sed plant nateraals• C The landscape plan shall include a narrative which addresses 1) Soil conditions. [ ] 2) Erosion control measures that will be used. N F) �►ign Drawings Sign drawings shall be submitted in accordance with Chapter 18.114 of the Code as part of Site Development Review or prior to obtaining a Building Permit to construct the sign. C G) Traffic_,generation estimate [ ] H) Pre 1i.minary partiti ►r, ear 'lot line a_,�,_ justment showing I No. of Copies • � )a�, of the subject parcel [ ] I I 1) The owner o o 2) The owner's authorized agent C ] 3) The map scale, (20,50,100 or 200 feet=1), inch north arrow and date C ] 4) Description of parcel location and boundaries [ ] ., 5) Location, width and names of streets, easements and other public ways within and adjacent to the parcel C ] : 6) Location of all permanent buildings on and within 25 feet of all property lines [ 3 7) Location and width of all water courses , [ ] 8 Location �o an f trees with th � or greater caliper Y 9 p at 4 feet above ground level [ ] 9) All slopes greater than 25% [ ] I 10) Location of 'existing utilities and utility easements C ] 11) For major land partition which creates a public street; a) The proposed right—of—way location and width C ] b) A scaled cross-section of the proposed street • ; plus any reserve strip. [ ] • tl 12) Any applicable deed restrictions - C 13) evidence that land partition will not preclude efficient future land division where applicable [ 3 I) Subdivision preli.minar .. P!lat M p and data 'shod, ing(No, of Copies 1) ale equaling a.rt 30 50 �.fJQ or 0 2 +� feettote ,� q � a the inch . . g and limited to one phase per sheet [ ] 1 C3 2) The p�r'opr,�sed name of the subdivision 3 Vicinity map showing property's relationship to arterial and collector streets 4) J' 4) Names, addresses and telephone numbers of the owner 5) developer, designer, pp icabler ] deer er•la:cat�on pl [ engineer, sur , � as � veyer finer ) a e of application h boun d ary lines of tra ct to be subdivided 7) Names of ad jac ent subdivision or names of recorded ,r owners of adjoining parcels of unsubdivided land [ 3 . 8) contour lines related t o acity-established bench- yl mark) at 2—foot intervals for 0.40% grades greater than 10 C APPLICATION C l LAS T Page e fl, • igkoI , 9) The r rose, location, type and size 111 of the following (within and adjacent to the ;iroposed : ' • subdivision): C a) Public and private right--of--ways and easements b) Public and private sanitary and storm sewer lines [ c) Domestic water mains including fire hydrants [ ] d) Major power telephone transmission lines . (50,000 volts or greater) e) Watercourses C • f) Deed reservations for parks, open space, pathways and other land encumbrances C3 10) Approximate plan and profiles of proposed sanitary and ' storm sewers with grades and pipe sizes indicated C 3 , . 11) Plan of the proposed water distribution system, showing pipe a e sizes and the location of valves P hydrant e.� . fire o 12) Approximate centerline profiles showing the finished n grade of all streets including street extensions for a reasonable distance beyond the limits of the proposed subdivision. I 13) Scaled cross sections of proposed street right-of--way; [ 14) The location of all areas subject to inundation or storm water overflow C � 15) Location, width and direction of sflow of all water- courses and drainage ways C 1.6) The proposed lot configurations, approximate lot dimensions and lot numbers. Where lusts are to be used for purposes other than residential, it shall be indicated upon such Tots. C 3 17) The location of all trees with a diameter 6 inches o- . greater measured at 4 feet above ground level, and the location of proposed tree plantings, if any [ ], 18) The existing uses of the property, including the location of all structures and the present uses of . the structures, and a statement of which structures are to remain after platting C 7 19) Supplemental information including; a) Proposed deed restrictions (if .any)' C b) Proof of property ownership C ] , c) A proposed plan for provision of subdivision ' improvements C ,r 20) i:xisting natural features including rock out- . pp � w� �n� information r t� y cro ing wetlands and marsh areas. C 21) If any of the foregoing ' ormation cannot practicably be shown on the preliminary plat, it shall be incorporated into a narrative and submitted with the application, t Other Information •.� APPLXCI TIO1 OW C►1 L IST - Page 4 f e � J • ,,, ( ..t' 1 d • d t,!: Oil 4 Y{{7 0CA d �i li . • i i . 1 4 1 0 d ,r i F IP • • 400 a ■ J (.3-7,,,,,,,,,.1� e 2 t. d 500 ; ' /36c b o rzdu,iauu u u Laa; #�! 'f60 � (C,S.'3867it) 414 . 800 ,�., d 40 �Y ' Ill if flP 8• , ' Al !{I d s► /.6/Ac. SO a f (349,67) r I I I , tits i ., • -: f : d (pH�fE I ) 2S "*tY;;c'. (r69 g2'rV 562:26) t 2 a lob p*` �1P a� ,.: MA 1 a4f tiw '' i s ` � � 40 (C.5 i5i937� k �� r .,, r „ .a I 1 " • ■ • , (PHASE 5) 1 • ` e I" ' �p y , 1 I n j' . , ......._.,, . ,.<._.M....,. t__..._,.... .,...•,_..,.w.i,..,,..,rte.._.. ... .• - ., _.,.,.....�.�.....u, m,v� .. - •, • , V _ ;'•'. .. S•e. y a A -t, .qu`1t r. +.�..t 9r��'' s I••,,,.' Avert �� ',,r:.� ) •4+ ,,, ,„ S qS 4.', . k•'S •«r•'�f C3%.9.yn,�s 5�.s•' Fs�••1i i9r :7 A•. y �`,•y K �YI v „,\ • , ! i' n • . . q. . °” 'SEE' MAP h 2S I IO DA f.C. ' . , .... , ,. • • �I ■ , ,� 1/4,-........., ,,,,,ii.................,......................,......., . . 0 . ° .00 a , ' r-eAC, 444 , . . ‘ 9 T (0 r P , � . . , .. ,��j 4 . , , . , , , „ _ 1 2 ,, . 'rl Li PHASE .,,, 1 I4) SEE I MAP � I )I 0(0a�AsE 15) ��✓ �25 1 tODB /,//Aci as r SUPPLEMENTAL MAP N I ' ft � „ , Y , r{ �t , (CY$.J54S� ,....4, , 1 (PHAE I I) ( ' ASt'Its w , ri + ' PHASE g1' 1 , I , - ' I , • • ■ • 1 • .. ,r:• C • • • • • 1 } d :•:::'::'':: : .� 'n,.; m� Imp %.:::•:•:,,,,.:.:,:-X.:::::::::::::::::::•:•:.:.:.:•:::. .- iiiii::;c gere� ::I:: , . ,.:,:::::::::::::,::::::::::::::::::::.:::::::::::::::::-::::::::: - - .... M:;::::::::::::::::: - I _ > n Si :;:.ii::. }:r ::rs' 'ri: wr:;;:ii.;:: ..••••• •••• ° W iiiiiiiiiiiiIiiil 111111111 NM . • HIE 0: :,>::%• sews'. ,,1",:„..:, tl ''. , 'ifii( -�i i � � Cr ;/..:.:.;e:•:.:::.:',.:::,::::::,:;:',.::::::::::::::: -4;; igi-a i ' ::::i t MINN IOW MIl� elI/ew1 II MII s iewsei■r f � L 1 IAII4 1• ?Si r 'r , , :'l:•:1'• ..::'l: MINI///// :•:i;i:':•r::., :� l' ■NIMINI MINI■ /M h��r■//�/ i� w 1 i*ii:,,,*i„:„.::::::::::::::::: ;;;;.q; /i0� w■ww I ■■ MI • 1 %,% i�ios In ww . 111111111111111111111 q.i'%y.:q.:.:%o-, s11II4 ■! j %i : ■d �M/ MMI ,iii r� ■ . I ■ I :i:i IEE: I ' * ,,:..;.:: _ ■■ww t' %: :::;:;, .,wsI „ N '1 h i�1 r : r: Ii ....cal ,' 1 ...;:::::::::•,•'..::::'::::::::::•:.: al 1 1 .,• .a. .1. i 1111111111111.11.11111 1 4r,4r::r• II ; r r r:• ■i ,�{, • 1 r (' 1 1 h ate. _ - • - 1 34ft0in 10 ft 0in RQin _- -< _ 2ft0 in 5 ft O In I I ir ,. >-- _ - -- - - -- - - ---- - - --_ - - _ - - - _ -• _ -- - - -- - - ---- Office Q '-5 { i ,....„ c. - -- _ _ I_____ ___ _k - , -II Bath .c to 1 • Canopy E s —.in. 1 F = I. Sales Area II tl `t a--- ------ Existing Residential :1 Q E . Structure (I °:I Remove Existing r to w . = _ • �1: I i • II Remove Masonry , ----- --- - `: Fireplace and wall .i � I( Replace.Existing Roof w e --_--------- - wiih Neer Vaulted C ding: } h, Lt t -11E r / .1 --T----r—. --r—r---T---T--T"--- I I ...L �! II i i i it 1 ii I I I a F r I I t iF - - - _ - - F _ T� :t t I I .1. 1 I i i I - —1—11 - I i-1 I� —lo ft 6 in �C 9.0 ft 6 ins �S ft 6 in 10 ft O in ii New Attached . Greenhouse i FI OOR PI AN - _ II • a oar .: .�; • „0` s% atc 6 t. , 4,-.._ c � O . 64.4 * �S L �- '.'. ex ¢s J` �;'_ a� yob$ s r . . b — f23 le- C ji '� a' .�0 Lab o-t . § .6.,_4 ., 3,e--4:,-„,..... --.. At ' ' Alta/ 144; E : v ci, . . . . -, , ,,, 4=-_,„... ,. ,.. .. .: .3 fte, 0 - - ems-art +� / - ,�. �+ _ . '= p6 P $ e - o � � �.l 0�s :: ° a� �`. iii, ►�y,,� 9QOd ' • --1- -8,. 4 , 4,,,„ 4 ye , T 0 0098 fxos�7) c e`jF-ma4%,..5.-....„, �® - _ :- -4 1 sec ,7� 3�.y = tla ` ft 0 /r 40 ~ ht ® _ 1 rs� ,t , • .,.... .. . -..-01 N 4 W la 1- So Oe .„-./ 1 `�' . '` .� t a / ril'il (too) (100)= ••, T• r re.-* „.- - = G30°OS'3trE) ' if / 1 . • e 411 - — Plan -�=gns Lied-ors Nursery Rear el Pla - �3300 SW Pacific i�iway _ _ Rim 532 The•Galleria 921 SW Morrison o�.: i Port1antd,OR 97205 (503)228-4926 (503)22&4 _� Date, No. . - -. • >T - ' a r t Golden I -Berkman: Liquid .. Damber I _' — �269.45' - - ----- --_--------_---_----- __- - Mugo Covered Display _ Area Pine - Ara - i -- M 1 Pave Over Existing --- - --- _ = :._ r __:::::_::._• . R 4....."....: f Display Area * Q.F£ `f< l I 14 Norway Loadin Area :;< I I 1 y• . ! --,. Spruce/ _ _ _ :_ I _— Row Plantings 1 f 1r ,-_2 Rhododendrons - - - with Irrigation Ditches a -fir' �� s t7 1 O - I - - I r Y • - l� -�__ :-„/�y -1 - _ : -__ - �: vice .;rR: _ 9 .i .g.--ai� {T\73• I]TY�TYT.YL: . _Mynla ,h ;\ \ t: - S 1 < - = o pt ° .- y i IiF Is, xxerv:::-: _ __ - Rhody .6-, I ' - r= I Seasonat:Flartrn r r._ • g - - �and Display - -- - P - - I 9 K i - - Flowering 90 Q 4 - g I - r D o and I tZ sprr,cg, _ -_ g+� / CO i f -- - I - _ -._ Existh g o , I; J _ _ �, 6'Fence -- Jam: — = I L— — -=-- I ; - I • c�a C lEsx— I ti� j — r _ r �9�.7.� I iiI:/"< 1 - - ' (::) _ , __ 4;E: I_ HC . White- �� '- i i f•- -Birch � --- ---F-_i -- I I _8 .le Remove ed-ditsg ' f Mountain I =caxreievrallcway •- -c' _. :: •*mlock Fro gags�gn Covered©isatay Area - - - - - _ _ . ,� (See Dalai`) - --------— f' - I t7 I I+ I - I - �. I a: r - Ground.Cover D la y Area Eiti :k:-.; L - - - - -•'. •" -.- •:•:.....��.:::...._�::::..::..:. ...._—:_¢_�-•:::._... -�l:-�:•:_.:..:._....:�::•�.•;••y:r•�:•:�j•:•...--•:•:::•:•�<:•:.•:�:•:::;..::....._.S.::::�:.tom::••••....:-:•._...:�-••:: Paved Parking Area: _ ::::: 1 __ Q @111 - rY -- 1 -`Mapia Grt'i • , , _ ,,,,,,1 _ —--_--- — -----=--_ -- C"Dia.Drainage erne _---- - / - 321.0° _ _ -- , f - 1 - • • t - 1 - 1-‘1.. 1/4_, 4 4 v 4. . - 44 ...„ • ,.9 v. , ..,___ _ ,, ... � O�3'� 0 . _ _ ta 5 .7�i ti • 0 oil 8 df j� p`� a10 6 - -�� s: 39� �� 83 01!lq �3 & �� , c _� i%(?.1. j � i-I r3 � - � lif .. - o.- t , s 0 (�6 , � $as ga19��5„_ __ _... s zso°'''_-r mo ;s:t - ' a', a I 9p Jai i e., . , r�.4_ ;.... _ f • iiiii 90049 1 0) a ._ _ �-rr 9OQ �• i i -ea o a I )331, 8 ', I ----3 - i i . 0 is' S J�a z 4. ICI •0 Iii 4• Ij • !� R 1' �' e�y - 4 - � a ik - — iu ki--16 1-1-t 4.1 AT.. _- - - _ -------- - ------ - i - _ - s ” - __ - 4... - - - _ - - - - - - - - - - - - -- - - - - - (too) - - t t!�?i?3. • i. CS te30`E} . ._ ._. __ _.__ ______",__ 1 'f - ebert -_ ,,_______ ___ , �.[ flSRnlS3ZTheGallen921SW Hecfior's Nursery Remodel Plan lt Morrison i�3fl�SW Pacific Nfwa Portland,OR 9203 {503 228-4926(5€ )228994 °� t - _ - - - -- - - --_ -- Date: ._ Data: a I1�0.i ' t • , • ..uai,�sr,...,.,..,.,1..,�e.., I ; ^ . , X' r,:ra..',•,rst r•!� ' 1 t+7! ,,,:�`r'4,;A.., , YJ,,«?4T\ f k4.:JfYL .+. r i,.A'fyA V,,, ' r �, ; �' Pr � , * 'k\i\J o 44 ), t;^at , r. { ...4,1.-�p ,,,, F,r , ,5; ar �•L + c • -, , ,- , }` F� k y• 4 u I i i g 9 • I ' 1• • i . • a I -r B 8 v e , r, , , „ F f7,0) C) . K } . , . . .. , 1 „ i � I ,., .t, ,. • , ! ,,---,,...... 1 , , eeb aS ,,, • 1 w ee'I '.'''''''''''*..t.C''.2.....'...'..''''........, I . *a .96Ac, `II 0 TO "" 40 1 M A' e� .d fit`' M. 1 , .1--. { , .. , , 1 . L . PHASE4. , . . SEE MAR 3 1.4A� E 15 F ► E 1 900 ,.29 1110DB iA � wn SUPP ENTAL; , � QPtCf � .. 5.,� S 49) a� , 1 . .. r /i), .' ) �. , 5,��7 �G, �� ,,,, , iiiC! 1 1 (Pi4ASE 6) Ili 1 1 I It! , , I I ' I ,, • • I " ' 'a,v l.,...X' �t ,I.;,fit°,,,,,, � t tt ��.� +fib �a ppyye(n P' .ST '�.f- + +, teyaf.v i ,.-. t 4 75' j- x tf ,.y,��i'a k i '': } 1" S `''......," :+ '`"Rr :'i IY4 Jy':4�5-yt 'lf"it' �"h"4.h 'r4 '''', `• r eS L'! x"''' "'+' :"''a tX"fi'°'� ,n tl, N h' �' Att,Se �Y(+ry XS;w.tS'+Y � rz�.{"�'�`"F"�tP rr�C�� . 1 + `� }} �c�}�R�Ta,r�, �3 r t, �S,y v fff' ,4 a i` . ! re t � 1_ #r 1 �.„v. ,4,- + ,.,ej • ..+ ',t+l�i� y+ v iu,t, X�_�„1."". ,, 7 A^.a� a 7 "ti'�, -,G+ -0J. u�r,°. ,-',a', t2'cq�! i3.f z 4^a; �v r e, 1'„. .. 7;�' h ,,, \i\i , '',„,%.‘,.. ' ' 0 . N - 0 f,4 Ty« i 7 F �, _' , -0 :sE1 t4,41000, , . { i ,,,,,,,,,„ I+s?s�,es (cf�r.spa . l • �o10•i' 1 �l • t ' CH'''.....'**4..';'''''''''''''''''''',.........,..,....,.,..,... 1d ,I�tA� AsE t3 j�f r y t i 4s AX p ,:' "y5Z ZS 1 TA 4-,,; �e4,- (J”)m ,1).-N x ' X i '2.) 1 M � p 1. 1 id f ' , ,, �� X ,• •1 . . . .. . , .. . , . . ., . . . , . . , . ' • • , . . . . . . , , . „ •. . ' ', . • , , ... , . . . . , . . . ., .' .. , .,,. ,. . ,. .' • '' , : . . • . . 00 FORM Ho.162--PECIAi.,WARRANTY.,DEED,IlnalsIdal or C?torabr). _ .._„.',. ,:., ,r.,....._,GTeVi140,14rpb LAW r.UOLIIII4INO 88-07962 ,. ,. ,• cq) • ( SPECIAL WARRANTY DEED ',, *,,,- , , •'Washington County ' --Cl' , • , ' .1YA KNOW ALL MEN BY THESE PRESENT'S,Thet„,„„,„,,....kl.40.s..'P?-4..g , 1:L.1:PaP.4c1.P- (id...P,q.r.§04,....‘,.,' r's‘ : and Bertha Clan:,:.:........,.:,......„...:_'..... ;............'....„......„.....'.........................".'..1.....—4 hereinafter called grantor, t II' for the consideration hereinafter stated,does hereby grant,bargain,sell and convey unto..,'... ,.,..„..,. .. . : • .: l' : Carl W. . ç 9r and Ethel V. Hect .. husband and mife, yith yiztt,t. of 'siiryivorship,,,,, ' ::. :, , • ' hereinafter called grantee, and unto grantee's'heirs successors and assigns all of that certain real property with the ,' ,, .•"' 41‘ tenements, hereditaments and appurtenances theretrnto belonging or in anywise a ppertainin g,situated in the County .: of,. I Was1:0-gg.t9Y-.?.....'.,State of Oregon,described as follows,to-wit:' . . , , . . : i" : !' , , , . See, Attached, Exhibit "A" , „ , , , , , . , . ! ■, . ''1, ' • • ' ,... • ,■..1. • t, ,r,,, .,-c 1,,,q , . , , I;,, ' •-4• ..................... ' , . 0 . . . ,",,. ; ' A:■.A.t1 -. .; WASHINGTON •OUNTY , '. 11 L.-:,.. :4 , itza st )7E44'ONOAMTfr rmANsrER: 1;0"' , .. • • , 1 • , , . . " 1!•,,,, .Al"' FISe PAID , , , , DATE, „ ' t, I , • ., . , IIP SPACE INSUPPICIENT,CONTINUE DESCRIPTION ON REVERSE SIDE) , . . • ' To Have and to Hold:the smile unto the said grantee and grantee's heirs,successors and:assigns,forever, • And the grantor hereby covenants to and with the, said grantee and grantee's:heii.s, successors and assigns . that said real property is free from encumbrances,:created or suffered thereon by grantor and that grantor will war- _ 'rant and defend the same and every,part and parcel against the lawful claims and'demands,'of all persons , '. , ,clainiing by, throogh,:Or under the grantor'. , . , • '— ' : The true and'actual Consideration paid for this tratisfei.,'stated hi,terms of dollars,:is$ .75,goo.o.o ' ,. .. , :,, .. . . ®However, the actual consideration consists of or includes other property or value given or:promised which is , Me whole ' . paft of ihe consideration(indicate w, ip e,1),,, (The sentence between the sYrnbols 0,it not applicable,should he deleted;See ORS 93.036) il. , ''in construing this deed and where the context so requires, the singular includes the plural andnll grammatical changes shall be implied to Malre the provisions hereof apply equally to corporations and to individuals.' In Witness Whereof,,the grantor has executed this instrument this „ , :.day of .,, ' : ' , ,19 ,; i' '• ...', ? , if a corporate grantor,it has caused'its name to be signed and seal affixed by ifs officers,duly Outho-ized thereto by order ot its board'ol directors. ' ;{ 41.-4T.4 ., THIS INSTRUMENT WILL NOT ALLOW USE OF THE PROPERTY OE. ........., . ..,, ,.., ,..—.....,........ —“.ece/i Lid '0,,, •' scrip:MO IN THIS INSTRUMENT IN VIOLATION O APPLICABLE LAND Nick Glan,-.: an -:-.' .. - . — . I' - ) , r USE LAWS AND REGULATIONS,'BEFORE SIGNING OR ACCEPTING , .,.,_, ,„:„ Glans,,.,. „...„.„' .. ....'„„„........'..: ...,,,r...........„..........„ . ' „ THIS INSTRUMENT, THE PERSON ACOUIRING,FEE'TITLE TO THE 'by il'ertnii... " uolid.. ,vatbr— PROPERTY SHOULD CHECK WITH' THE APPROPRIATE CITY or/, ii, 4.1.? . ,..,. ...,1Z,.....21Y.,....... -.. , ,!„...„...,..,....;..,......... ,1' , ,,,,,• : , COUNTY PLANNING oEpARTMENT TO VERIFY APPROVED IA•Es, f%-— • - , • l',' . . srAD,E OP'DEEGdNx ' ' STATE CriPbatoChtiolity of ' ,)8, sib c •. • ,' CoarqA of „.,....904.4a- • , )1p...,.........,. , 71ittrex.„•'.•/,.Z. • ,.19.ki.':..... Pereonally appeared • , and •. , ...............................;........................,..•..,...................Who,'being,duly StVotrt, . . . , Betha each for himself and not one for the other,did say',that the tortner,is the , Personally appeared tte noove_nanied..„—.....,.....,... 1 Giant for hersel r,and' tor Nick Glans president and that the latter is the . , 4,14_,-Iffe.„44ZUSIii,l_parx.,.orl ol‘c.Aitel 1/4,P4 .--, . ..„—...„........„.secretory Ol, . . ....,..............,...',..,......... odpokno ...................,....... )a'aartJaiatiaa) , ' ' 'Itvieddcd Me foregoing inStru- tied!het the,seal aliked id the lotegoing inatrtinient la the corporate sent ii , • J.r'.' and, di of said corporation end Mot anklIniStrumetit tvds signed end tented IN be- hell of said corporntion by authority ol its board ol directors;and elicit of•• ,''i, , , l'. ••.'''.'...' them nelmowledged sold'Thstrotnerit to be 110 voluntary act and tided, ' "f 1•, ' ',•'(i( ,. , 13.didco,ii,,o,L,--- )„,, l / I . , „ t3di3Oto nib' , ebirkielAt,' .",..:„. :,),:e.,' .*4 '-',. a. ''., - ....,. (OPPICIAL I ' ..........,.'..,.;......,,....4:,..,..,..„..:.........,. ,: : 's.8.4L) ' , ••, s.,:Wiltd?..$,Pliblie few OreileP :1" : IVaiitr$,Public for Oregon . ' .. • • i 1, ,, .,,, , :lifytditiiiiiiiion expires..:..?;.•7.4,;kr..?•;,•,;..... My tominisitoii expires t' Ill OibtUfilt iet by b tOtttiatil, M thipotuit 001) . '. ,ii' ' ■ '1.. o' Oa 4,, , arthatti. ,,' ' SPAPE OP OREOON, , 1 . , • . CoUrity of ,..---.......-J iiii;‘,4 4.8..4I4iii.krI.e-ii;iIiiiiiii : .1 certify that the within iii$titi, 'l' Carl. .8i.,..8.1:h1,.,14. c toi‘ ,. . ..„,.: ..., , , ' , 'Merit 'WEIS te0eiVect for record ti tile ,„.....,. day Of.......,.............................)19.--.4 '' i ...-Tig6t.ti 4,,IIrogari.,.,.97 223....„.,,.......,.,,.•, ,, , at.......,,....,,,"'d,olock.,.....Mq and recorded anAN'thwa NAM Atib Additth a,' , ''' - ' ---- el-A FW80Y,0 iri hri ditita6ifidititile.Nti,,,L........:,,,,,,,,...oii I • Alio tieolitlifti tailiiii let " r igige 0 r tfs tee/tildriit.oitt M . & gra., oat 1 14..e tot , , ,r4k80e8#e.e titer; , , ....... .... " ' r.'"'.'' ' itaOhti mictolihrt itedetitiori, No,....—.'...'....., , , • "-ni4ia''' Oi‘g611. ,912-2 Pacatd at tbeeds at said,cauhty. Witaass my l'ititid ai-tc V.saai of 14A mk,A00ilbS,ill, County a/liked. Unlit ei iham,it taitutiltit alto kibliiiiiiiiti iliiill be cwt to gin iolloWIrla titletitit, . Same, as Obbve NAME TITLE . , . , ,' , riATi.iiz,A b6R th§,tit. . • /-,-., .:: , 7.--..-.....-..7...'"''''''''...... , . • ,1 , , , , . , . , ' ' ,• 1 . . r. N r • 4 1, A : ,, t■ A , , ■ ' • • ■ ,I EXHIBIT ,,,An A portion of Lot 1,0, WILLOWBROOK FARM, in the City of, Tigard, • ' County of Washington and State of Oregon, described an follows: • .. ` Beginning at: A '5/0 inch :iron rod'at the intersection of'-the Easterly ' line r5 f' Pacific Highway (Highway 99--West) with a line 25.0 feet Southwesterly from '(when :measured at right angles to), the center ' line of 'Nueva Road (Washington County Road No. 900) ; thence' Soutl'71 '62,',48! East' o,n a line paralleJ with the center line UC said' fJaeve Road, 4 0l.:ytar.ttee of 2(�2.72 feet;:; thence South '0°06'30" Rangy 120.8r.>,' . "—Coot l,r; a tia.r at' hho 1.r'ue.: point of beginning; Of the tract hevt In described; thence continuing South 0°O6'30H East 100:00 feet to A ' ' • bar,: thence North'' 89°'5,,2' 'West 321.001 feet to a point in the Easterly ' ' ' right-of' line of S.W. Pacific Highway; .thence Northerly' 28.00 • I . feet along said .right-of-way lino and along,the are Iof a 2905.0 foot • radius u.uvve to the let! to a pipe',at the end;:Of a curve; thence ' ', North' 1'1°18'30", East 75.1'ff' feet to a bar; thence South 89"'52', East, , . • 2Y11.7'? Peat, to the true point of beginn i.n1 . ., ' PAARCEL' 1:C I f't portion oi' Lo't 10, Wf,LLOWBROOK' FARM, in 'the' City' of Tigard,, County of Washington arld' ,State of Oregon described as flai lows beginning at a 5/8 inch iron rood at the interesectiorl of the Easterly line of Pacific Highway (Highway: 99-West) With a' line 25.0 '.f eet; • - Southwesterly from (when, measured at right angles to)'' the center line of Naeve,,Road (Wci''shington County Road No. 900); thence South ' 62°48,' East' on a line iarallel with the center line of said Iiaeve ' 'Road 262.12 feet; thence South 0°OF.i1011'' East 20.85 'feet to the true point of beginning of the bract herein described; thence' continuing South U°iD6,t 3p!t East 100.D feet to a bar; 'thence North 89°52 t 1,West ', . ' 91t,73 feet to 'a bar in the Easterly night-o'f-may line of S.W.' Pacific I , Hi,,ghway; 'then'ce North l4°Ii8'3O" East 103.14' feet along said right-of- way line to a bay; thence South 89°52' East 269.115 feet to the true ' point of beginning. STATE OF OREGON ' Coun o a SS f Washington I,Donald W,Mason,Director of Assossrrie t n and taxation and Cx•Officla Recorder of Co,'. veyahces for said county,do hereby certify plat the within instrument of writing Was received , and recorded in book of redords of said county, -,• I Dohaid W. Mason, Director of Assesstneht and Taxation, Exs • Officio County Clerk • '19DB rEt3 28 AI ii : 14 r , I . ■J Y, it. .•....,. r... .,. .. .w........ .. . n • [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing] [Page Too Large for OCR Processing]